1. Document Metadata
format-version |
1.2 |
date |
2020:06:09 11:01 |
2. Definitions and Terms
| saved-by | psi-pi_team | default-namespace | UNIMOD
[#UNIMOD:0] === UNIMOD:0 unimod root node .Term [UNIMOD:0] [cols="2*"] |
| id | UNIMOD:0 | name | unimod root node | def | "The root node of the unimod modifications ontology." [UNIMOD:0]
[#UNIMOD:1] === UNIMOD:1 Acetyl .Term [UNIMOD:1] [cols="2*"] |
| id | UNIMOD:1 | name | Acetyl | def | "Acetylation." [RESID:AA0048, RESID:AA0049, RESID:AA0041, RESID:AA0052, RESID:AA0364, RESID:AA0056, RESID:AA0046, RESID:AA0051, RESID:AA0045, RESID:AA0354, RESID:AA0044, RESID:AA0043, PMID:11999733, URL:http\://www.ionsource.com/Card/acetylation/acetylation.htm, RESID:AA0055, PMID:14730666, PMID:15350136, RESID:AA0047, PMID:12175151, PMID:11857757, RESID:AA0042, RESID:AA0050, RESID:AA0053, RESID:AA0054, FindMod:ACET, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1] | xref | record_id "1" | xref | delta_mono_mass "42.010565" | xref | delta_avge_mass "42.0367" | xref | delta_composition "H(2) C(2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2017-11-08 16:08:56" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | xref | spec_1_misc_notes "PT and GIST acetyl light" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Multiple" | xref | spec_2_misc_notes "GIST acetyl light" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "C" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_5_group "5" | xref | spec_5_hidden "0" | xref | spec_5_site "N-term" | xref | spec_5_position "Protein N-term" | xref | spec_5_classification "Post-translational" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Post-translational" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "Y" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Chemical derivative" | xref | spec_7_misc_notes "O-acetyl" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "H" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Chemical derivative" | xref | spec_9_group "9" | xref | spec_9_hidden "1" | xref | spec_9_site "R" | xref | spec_9_position "Anywhere" | xref | spec_9_classification "Artefact" | xref | spec_9_misc_notes "glyoxal-derived hydroimidazolone" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2] === UNIMOD:2 Amidated |
null .Term [UNIMOD:2] [cols="2*"] |
| id | UNIMOD:2 | name | Amidated | def | "Amidation." [RESID:AA0088, RESID:AA0087, RESID:AA0086, RESID:AA0085, RESID:AA0084, RESID:AA0083, RESID:AA0082, RESID:AA0081, RESID:AA0089, RESID:AA0090, RESID:AA0091, RESID:AA0092, RESID:AA0093, RESID:AA0094, RESID:AA0095, RESID:AA0096, RESID:AA0097, RESID:AA0098, RESID:AA0099, RESID:AA0100, FindMod:AMID, PMID:14588022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2] | synonym | "Top-Down sequencing c-type fragment ion" [] | xref | record_id "2" | xref | delta_mono_mass "-0.984016" | xref | delta_avge_mass "-0.9848" | xref | delta_composition "H N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2010-06-28 10:52:25" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_2_misc_notes "MS/MS experiments of mass spectrometric c-ions (MS^3) can be used for protein identification by library searching. T3-sequencing is such a technique (see reference). Search engines must recognize this as a virtual modification." | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:3] === UNIMOD:3 Biotin |
null .Term [UNIMOD:3] [cols="2*"] |
| id | UNIMOD:3 | name | Biotin | def | "Biotinylation." [RESID:AA0117, FindMod:BIOT, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=3] | xref | record_id "3" | xref | delta_mono_mass "226.077598" | xref | delta_avge_mass "226.2954" | xref | delta_composition "H(14) C(10) N(2) O(2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2017-10-09 15:45:09" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:4] === UNIMOD:4 Carbamidomethyl |
null .Term [UNIMOD:4] [cols="2*"] |
| id | UNIMOD:4 | name | Carbamidomethyl | def | "Iodoacetamide derivative." [PMID:11510821, PMID:12422359, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=4] | synonym | "Carboxyamidomethylation" [] | xref | record_id "4" | xref | delta_mono_mass "57.021464" | xref | delta_avge_mass "57.0513" | xref | delta_composition "H(3) C(2) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2017-10-09 10:27:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "0" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Artefact" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "D" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Artefact" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "E" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Artefact" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "S" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Artefact" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "T" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Artefact" | xref | spec_9_group "9" | xref | spec_9_hidden "1" | xref | spec_9_site "Y" | xref | spec_9_position "Anywhere" | xref | spec_9_classification "Artefact" | xref | spec_10_group "10" | xref | spec_10_hidden "1" | xref | spec_10_site "U" | xref | spec_10_position "Anywhere" | xref | spec_10_classification "Chemical derivative" | xref | spec_11_group "11" | xref | spec_11_hidden "1" | xref | spec_11_site "M" | xref | spec_11_position "Anywhere" | xref | spec_11_classification "Chemical derivative" | xref | spec_11_neutral_loss_0_mono_mass "0" | xref | spec_11_neutral_loss_0_avge_mass "0" | xref | spec_11_neutral_loss_0_flag "false" | xref | spec_11_neutral_loss_0_composition "0" | xref | spec_11_neutral_loss_106_mono_mass "105.024835" | xref | spec_11_neutral_loss_106_avge_mass "105.1588" | xref | spec_11_neutral_loss_106_flag "false" | xref | spec_11_neutral_loss_106_composition "H(7) C(3) N O S" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:5] === UNIMOD:5 Carbamyl |
null .Term [UNIMOD:5] [cols="2*"] |
| id | UNIMOD:5 | name | Carbamyl | def | "Carbamylation." [PMID:12203680, RESID:AA0343, PMID:10978403, RESID:AA0332, URL:http\://www.ionsource.com/Card/carbam/carbam.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=5] | comment | Carbamylation is an irreversible process of non-enzymatic modification of proteins by the breakdown products of urea isocyanic acid reacts with the N-term of a proteine or side chains of lysine and arginine residues. | xref | record_id "5" | xref | delta_mono_mass "43.005814" | xref | delta_avge_mass "43.0247" | xref | delta_composition "H C N O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2011-11-21 13:06:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Multiple" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "R" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Artefact" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "C" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Artefact" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "M" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Artefact" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "S" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "T" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Chemical derivative" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "Y" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Chemical derivative" | xref | spec_9_group "9" | xref | spec_9_hidden "1" | xref | spec_9_site "N-term" | xref | spec_9_position "Protein N-term" | xref | spec_9_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:6] === UNIMOD:6 Carboxymethyl |
null .Term [UNIMOD:6] [cols="2*"] |
| id | UNIMOD:6 | name | Carboxymethyl | def | "Iodoacetic acid derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=6] | synonym | "Carboxymethylation" [] | xref | record_id "6" | xref | delta_mono_mass "58.005479" | xref | delta_avge_mass "58.0361" | xref | delta_composition "H(2) C(2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2016-02-01 14:17:55" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "W" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_4_misc_notes "Hydroxylethanone" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "U" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:7] === UNIMOD:7 Deamidated |
null .Term [UNIMOD:7] [cols="2*"] |
| id | UNIMOD:7 | name | Deamidated | def | "Deamidation." [PMID:6838602, RESID:AA0214, URL:http\://www.ionsource.com/Card/Deamidation/deamidation.htm, FindMod:CITR, RESID:AA0128, FindMod:FLAC, PMID:15700232, FindMod:DEAM, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=7] | synonym | "phenyllactyl from N-term Phe Citrullination" [] | xref | record_id "7" | xref | delta_mono_mass "0.984016" | xref | delta_avge_mass "0.9848" | xref | delta_composition "H(-1) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2018-10-25 09:32:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_misc_notes "Convertion of glycosylated asparagine residues upon deglycosylation with PNGase F in H2O" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_2_misc_notes "Protein which is post-translationally modified by the de-imination of one or more arginine residues; Peptidylarginine deiminase (PAD) converts protein bound to citrulline" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_44_mono_mass "43.005814" | xref | spec_2_neutral_loss_44_avge_mass "43.0247" | xref | spec_2_neutral_loss_44_flag "false" | xref | spec_2_neutral_loss_44_composition "H C N O" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "F" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:8] === UNIMOD:8 ICAT-G |
null .Term [UNIMOD:8] [cols="2*"] |
| id | UNIMOD:8 | name | ICAT-G | def | "Gygi ICAT™ d0." [PMID:10504701, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=8] | xref | record_id "8" | xref | delta_mono_mass "486.251206" | xref | delta_avge_mass "486.6253" | xref | delta_composition "H(38) C(22) N(4) O(6) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 17:00:43" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:9] === UNIMOD:9 ICAT-G:2H(8) |
null .Term [UNIMOD:9] [cols="2*"] |
| id | UNIMOD:9 | name | ICAT-G:2H(8) | def | "Gygi ICAT™ d8." [PMID:10504701, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=9] | xref | record_id "9" | xref | delta_mono_mass "494.30142" | xref | delta_avge_mass "494.6746" | xref | delta_composition "H(30) 2H(8) C(22) N(4) O(6) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 17:01:35" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:10] === UNIMOD:10 Met→Hse |
null .Term [UNIMOD:10] [cols="2*"] |
| id | UNIMOD:10 | name | Met→Hse | def | "Homoserine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=10] | comment | Cyanogen bromide (CNBr) cleavage converts the C-term Met to either homoserine or homoserine lactone, depending on pH. | xref | record_id "10" | xref | delta_mono_mass "-29.992806" | xref | delta_avge_mass "-30.0922" | xref | delta_composition "H(-2) C(-1) O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-13 15:40:08" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "M" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:11] === UNIMOD:11 Met→Hsl |
null .Term [UNIMOD:11] [cols="2*"] |
| id | UNIMOD:11 | name | Met→Hsl | def | "Homoserine lactone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=11] | comment | Cyanogen bromide (CNBr) cleavage converts the C-term Met to either homoserine or homoserine lactone, depending on pH. | xref | record_id "11" | xref | delta_mono_mass "-48.003371" | xref | delta_avge_mass "-48.1075" | xref | delta_composition "H(-4) C(-1) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-11-14 11:10:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "M" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:12] === UNIMOD:12 ICAT-D:2H(8) |
null .Term [UNIMOD:12] [cols="2*"] |
| id | UNIMOD:12 | name | ICAT-D:2H(8) | def | "Applied Biosystems original ICAT™ d8." [URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/images/icat_reagent.gif, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=12] | xref | record_id "12" | xref | delta_mono_mass "450.275205" | xref | delta_avge_mass "450.6221" | xref | delta_composition "H(26) 2H(8) C(20) N(4) O(5) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 16:56:23" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:13] === UNIMOD:13 ICAT-D |
null .Term [UNIMOD:13] [cols="2*"] |
| id | UNIMOD:13 | name | ICAT-D | def | "Applied Biosystems original ICAT™ d0." [URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/images/icat_reagent.gif, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=13] | xref | record_id "13" | xref | delta_mono_mass "442.224991" | xref | delta_avge_mass "442.5728" | xref | delta_composition "H(34) C(20) N(4) O(5) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 16:53:48" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:17] === UNIMOD:17 NIPCAM |
null .Term [UNIMOD:17] [cols="2*"] |
| id | UNIMOD:17 | name | NIPCAM | def | "N-isopropylcarboxamidomethyl." [PMID:8465942, PMID:11465505, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=17] | synonym | "Dimethylacrylamide, DMA" [] | xref | record_id "17" | xref | delta_mono_mass "99.068414" | xref | delta_avge_mass "99.1311" | xref | delta_composition "H(9) C(5) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 12:39:14" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:20] === UNIMOD:20 PEO-Iodoacetyl-LC-Biotin |
null .Term [UNIMOD:20] [cols="2*"] |
| id | UNIMOD:20 | name | PEO-Iodoacetyl-LC-Biotin | def | "Biotinyl-iodoacetamidyl-3,6-dioxaoctanediamine." [PMID:12038753, PMID:15253424, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=20] | synonym | "Pierce EZ-Link PEO-Iodoacetyl Biotin" [] | xref | record_id "20" | xref | delta_mono_mass "414.193691" | xref | delta_avge_mass "414.5196" | xref | delta_composition "H(30) C(18) N(4) O(5) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-11-14 11:40:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:21] === UNIMOD:21 Phospho |
null .Term [UNIMOD:21] [cols="2*"] |
| id | UNIMOD:21 | name | Phospho | def | "Phosphorylation." [RESID:AA0036, URL:http\://www.ionsource.com/Card/phos/phos.htm, RESID:AA0037, RESID:AA0033, RESID:AA0038, RESID:AA0039, RESID:AA0222, FindMod:PHOS, RESID:AA0034, RESID:AA0035, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=21] | comment | Neutral loss of phosphate is typically observed from Y/H/D/E/K/C, rather than the preferential loss of phosphoric acid from S/T. | xref | record_id "21" | xref | delta_mono_mass "79.966331" | xref | delta_avge_mass "79.9799" | xref | delta_composition "H O(3) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2018-08-13 13:42:59" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_neutral_loss_98_mono_mass "97.976896" | xref | spec_1_neutral_loss_98_avge_mass "97.9952" | xref | spec_1_neutral_loss_98_flag "false" | xref | spec_1_neutral_loss_98_composition "H(3) O(4) P" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_98_mono_mass "97.976896" | xref | spec_1_neutral_loss_98_avge_mass "97.9952" | xref | spec_1_neutral_loss_98_flag "false" | xref | spec_1_neutral_loss_98_composition "H(3) O(4) P" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "Y" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "D" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_3_misc_notes "Rare" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_4_misc_notes "Rare" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "C" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Post-translational" | xref | spec_5_misc_notes "Rare" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "R" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Post-translational" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "K" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Post-translational" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "E" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:23] === UNIMOD:23 Dehydrated |
null .Term [UNIMOD:23] [cols="2*"] |
| id | UNIMOD:23 | name | Dehydrated | def | "Dehydration." [FindMod:DHAS, RESID:AA0303, RESID:AA0302, RESID:AA0181, RESID:AA0182, FindMod:DHB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=23] | synonym | "didehydroalanine C-terminal imide Prompt loss of phosphate from phosphorylated residue D-Succinimide" [] | xref | record_id "23" | xref | delta_mono_mass "-18.010565" | xref | delta_avge_mass "-18.0153" | xref | delta_composition "H(-2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-11-14 11:05:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Q" | xref | spec_2_position "Protein C-term" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "S" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_3_misc_notes "beta-elimination" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "T" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_4_misc_notes "beta-elimination" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "Y" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Post-translational" | xref | spec_5_misc_notes "beta-elimination" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "D" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | xref | spec_7_group "7" | xref | spec_7_hidden "0" | xref | spec_7_site "C" | xref | spec_7_position "Any N-term" | xref | spec_7_classification "Artefact" | xref | spec_7_misc_notes "Pyro-carboxymethyl as a delta from Carboxymethyl-Cys" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:24] === UNIMOD:24 Propionamide |
null .Term [UNIMOD:24] [cols="2*"] |
| id | UNIMOD:24 | name | Propionamide | def | "Acrylamide adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=24] | xref | record_id "24" | xref | delta_mono_mass "71.037114" | xref | delta_avge_mass "71.0779" | xref | delta_composition "H(5) C(3) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2010-12-21 16:57:03" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:25] === UNIMOD:25 Pyridylacetyl |
null .Term [UNIMOD:25] [cols="2*"] |
| id | UNIMOD:25 | name | Pyridylacetyl | def | "Pyridylacetyl." [PMID:9276974, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=25] | xref | record_id "25" | xref | delta_mono_mass "119.037114" | xref | delta_avge_mass "119.1207" | xref | delta_composition "H(5) C(7) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 12:47:43" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:26] === UNIMOD:26 Pyro-carbamidomethyl |
null .Term [UNIMOD:26] [cols="2*"] |
| id | UNIMOD:26 | name | Pyro-carbamidomethyl | def | "S-carbamoylmethylcysteine cyclization (N-terminus)." [PMID:12643538, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=26] | comment | Cyclisation of N-term Carbamidomethyl-Cys or Carboxymethyl-Cys. The delta is relative to Cys. For a delta relative to alkylated Cys, see Ammonia-loss and Dehydrated. | synonym | "Carboxymethyl-Cys cyclization (N-terminus) Carbamidomethyl-Cys cyclization (N-terminus)" [] | xref | record_id "26" | xref | delta_mono_mass "39.994915" | xref | delta_avge_mass "40.0208" | xref | delta_composition "C(2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-11-14 11:05:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:27] === UNIMOD:27 Glu→pyro-Glu |
null .Term [UNIMOD:27] [cols="2*"] |
| id | UNIMOD:27 | name | Glu→pyro-Glu | def | "Pyro-glu from E." [RESID:AA0031, PMID:8442665, FindMod:PYRE, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=27] | xref | record_id "27" | xref | delta_mono_mass "-18.010565" | xref | delta_avge_mass "-18.0153" | xref | delta_composition "H(-2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2008-06-05 13:54:56" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "E" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:28] === UNIMOD:28 Gln→pyro-Glu |
null .Term [UNIMOD:28] [cols="2*"] |
| id | UNIMOD:28 | name | Gln→pyro-Glu | def | "Pyro-glu from Q." [RESID:AA0031, FindMod:PYRR, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=28] | xref | record_id "28" | xref | delta_mono_mass "-17.026549" | xref | delta_avge_mass "-17.0305" | xref | delta_composition "H(-3) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-13 17:06:57" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "Q" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:29] === UNIMOD:29 SMA |
null .Term [UNIMOD:29] [cols="2*"] |
| id | UNIMOD:29 | name | SMA | def | "N-Succinimidyl-2-morpholine acetate." [PMID:10446193, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=29] | xref | record_id "29" | xref | delta_mono_mass "127.063329" | xref | delta_avge_mass "127.1412" | xref | delta_composition "H(9) C(6) N O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2010-11-03 17:44:14" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:30] === UNIMOD:30 Cation:Na |
null .Term [UNIMOD:30] [cols="2*"] |
| id | UNIMOD:30 | name | Cation:Na | def | "Sodium adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=30] | comment | Proton replaced by sodium cation. | xref | record_id "30" | xref | delta_mono_mass "21.981943" | xref | delta_avge_mass "21.9818" | xref | delta_composition "H(-1) Na" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-14 19:43:17" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:31] === UNIMOD:31 Pyridylethyl |
null .Term [UNIMOD:31] [cols="2*"] |
| id | UNIMOD:31 | name | Pyridylethyl | def | "S-pyridylethylation." [PMID:11760118, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=31] | xref | record_id "31" | xref | delta_mono_mass "105.057849" | xref | delta_avge_mass "105.1372" | xref | delta_composition "H(7) C(7) N" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 12:43:38" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:34] === UNIMOD:34 Methyl |
null .Term [UNIMOD:34] [cols="2*"] |
| id | UNIMOD:34 | name | Methyl | def | "Methylation." [RESID:AA0105, PMID:11875433, RESID:AA0072, RESID:AA0299, RESID:AA0337, RESID:AA0317, RESID:AA0273, RESID:AA0234, RESID:AA0073, RESID:AA0070, RESID:AA0071, RESID:AA0076, RESID:AA0272, RESID:AA0305, RESID:AA0336, RESID:AA0069, RESID:AA0065, RESID:AA0063, RESID:AA0061, RESID:AA0064, RESID:AA0338, RESID:AA0318, FindMod:METH, URL:http\://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=2921173&tool=pmcentrez&rendertype=abstract, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=34] | synonym | "methyl ester" [] | xref | record_id "34" | xref | delta_mono_mass "14.01565" | xref | delta_avge_mass "14.0266" | xref | delta_composition "H(2) C" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2015-08-26 14:39:25" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "N-term" | xref | spec_5_position "Any N-term" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Q" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Post-translational" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "R" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Post-translational" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "I" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Post-translational" | xref | spec_9_group "9" | xref | spec_9_hidden "1" | xref | spec_9_site "L" | xref | spec_9_position "Anywhere" | xref | spec_9_classification "Post-translational" | xref | spec_10_group "10" | xref | spec_10_hidden "1" | xref | spec_10_site "N-term" | xref | spec_10_position "Protein N-term" | xref | spec_10_classification "Post-translational" | xref | spec_11_group "11" | xref | spec_11_hidden "0" | xref | spec_11_site "C-term" | xref | spec_11_position "Any C-term" | xref | spec_11_classification "Multiple" | xref | spec_12_group "12" | xref | spec_12_hidden "0" | xref | spec_12_site "E" | xref | spec_12_position "Anywhere" | xref | spec_12_classification "Post-translational" | xref | spec_12_group "12" | xref | spec_12_hidden "0" | xref | spec_12_site "D" | xref | spec_12_position "Anywhere" | xref | spec_12_classification "Post-translational" | xref | spec_13_group "13" | xref | spec_13_hidden "1" | xref | spec_13_site "S" | xref | spec_13_position "Anywhere" | xref | spec_13_classification "Post-translational" | xref | spec_14_group "14" | xref | spec_14_hidden "1" | xref | spec_14_site "T" | xref | spec_14_position "Anywhere" | xref | spec_14_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:35] === UNIMOD:35 Oxidation |
null .Term [UNIMOD:35] [cols="2*"] |
| id | UNIMOD:35 | name | Oxidation | def | "Oxidation or Hydroxylation." [RESID:AA0027, PMID:11461766, RESID:AA0029, RESID:AA0028, RESID:AA0030, PMID:9004526, RESID:AA0205, RESID:AA0146, FindMod:DOPA, RESID:AA0215, FindMod:CSEA, RESID:AA0026, PMID:14661084, PMID:15569593, PMID:11120890, PMID:11212008, RESID:AA0322, RESID:AA0235, FindMod:HYDR, PMID:14661085, PMID:12781462, PMID:2057999, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=35] | xref | record_id "35" | xref | delta_mono_mass "15.994915" | xref | delta_avge_mass "15.9994" | xref | delta_composition "O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2017-10-06 17:05:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_misc_notes "3-hydroxyaspartic acid" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_3_misc_notes "3-hydroxyasparagine" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "P" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_4_misc_notes "glutamic semialdehyde" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "F" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Artefact" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Post-translational" | xref | spec_6_misc_notes "dihydroxyphenylalanine (DOPA)" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "R" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Post-translational" | xref | spec_8_group "8" | xref | spec_8_hidden "0" | xref | spec_8_site "M" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Artefact" | xref | spec_8_misc_notes "methionine sulfoxide" | xref | spec_8_neutral_loss_0_mono_mass "0" | xref | spec_8_neutral_loss_0_avge_mass "0" | xref | spec_8_neutral_loss_0_flag "false" | xref | spec_8_neutral_loss_0_composition "0" | xref | spec_8_neutral_loss_64_mono_mass "63.998285" | xref | spec_8_neutral_loss_64_avge_mass "64.1069" | xref | spec_8_neutral_loss_64_flag "false" | xref | spec_8_neutral_loss_64_composition "H(4) C O S" | xref | spec_9_group "9" | xref | spec_9_hidden "1" | xref | spec_9_site "C" | xref | spec_9_position "Anywhere" | xref | spec_9_classification "Post-translational" | xref | spec_9_misc_notes "sulfenic acid" | xref | spec_10_group "10" | xref | spec_10_hidden "0" | xref | spec_10_site "W" | xref | spec_10_position "Anywhere" | xref | spec_10_classification "Artefact" | xref | spec_10_group "10" | xref | spec_10_hidden "0" | xref | spec_10_site "H" | xref | spec_10_position "Anywhere" | xref | spec_10_classification "Artefact" | xref | spec_10_misc_notes "2-oxohistidine" | xref | spec_11_group "11" | xref | spec_11_hidden "1" | xref | spec_11_site "G" | xref | spec_11_position "Any C-term" | xref | spec_11_classification "Pre-translational" | xref | spec_11_misc_notes "Hydroxyglycine derivative in amidation pathway" | xref | spec_12_group "12" | xref | spec_12_hidden "1" | xref | spec_12_site "U" | xref | spec_12_position "Anywhere" | xref | spec_12_classification "Multiple" | xref | spec_13_group "13" | xref | spec_13_hidden "1" | xref | spec_13_site "E" | xref | spec_13_position "Anywhere" | xref | spec_13_classification "Chemical derivative" | xref | spec_13_misc_notes "hydroxyglutamic acid" | xref | spec_14_group "14" | xref | spec_14_hidden "1" | xref | spec_14_site "I" | xref | spec_14_position "Anywhere" | xref | spec_14_classification "Chemical derivative" | xref | spec_15_group "15" | xref | spec_15_hidden "1" | xref | spec_15_site "L" | xref | spec_15_position "Anywhere" | xref | spec_15_classification "Chemical derivative" | xref | spec_16_group "16" | xref | spec_16_hidden "1" | xref | spec_16_site "Q" | xref | spec_16_position "Anywhere" | xref | spec_16_classification "Chemical derivative" | xref | spec_17_group "17" | xref | spec_17_hidden "1" | xref | spec_17_site "S" | xref | spec_17_position "Anywhere" | xref | spec_17_classification "Chemical derivative" | xref | spec_18_group "18" | xref | spec_18_hidden "1" | xref | spec_18_site "T" | xref | spec_18_position "Anywhere" | xref | spec_18_classification "Chemical derivative" | xref | spec_19_group "19" | xref | spec_19_hidden "1" | xref | spec_19_site "V" | xref | spec_19_position "Anywhere" | xref | spec_19_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:36] === UNIMOD:36 Dimethyl |
null .Term [UNIMOD:36] [cols="2*"] |
| id | UNIMOD:36 | name | Dimethyl | def | "Di-Methylation." [FindMod:DIMETH, RESID:AA0311, RESID:AA0068, PMID:14570711, RESID:AA0067, PMID:12964758, RESID:AA0075, RESID:AA0066, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=36] | xref | record_id "36" | xref | delta_mono_mass "28.0313" | xref | delta_avge_mass "28.0532" | xref | delta_composition "H(4) C(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2014-11-16 07:37:54" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "P" | xref | spec_5_position "Protein N-term" | xref | spec_5_classification "Post-translational" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "N-term" | xref | spec_6_position "Protein N-term" | xref | spec_6_classification "Isotopic label" | xref | spec_6_misc_notes "When dimethyl labelling is pre-digest" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:37] === UNIMOD:37 Trimethyl |
null .Term [UNIMOD:37] [cols="2*"] |
| id | UNIMOD:37 | name | Trimethyl | def | "Tri-Methylation." [FindMod:TRIMETH, RESID:AA0062, RESID:AA0074, PMID:12590383, URL:http\://pir.georgetown.edu/resid/faq.shtml#q12, URL:http\://www.cancerci.com/content/1/1/3, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=37] | xref | record_id "37" | xref | delta_mono_mass "42.04695" | xref | delta_avge_mass "42.0797" | xref | delta_composition "H(6) C(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2015-05-22 13:05:59" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_60_mono_mass "59.073499" | xref | spec_1_neutral_loss_60_avge_mass "59.1103" | xref | spec_1_neutral_loss_60_flag "false" | xref | spec_1_neutral_loss_60_composition "H(9) C(3) N" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "A" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:39] === UNIMOD:39 Methylthio |
null .Term [UNIMOD:39] [cols="2*"] |
| id | UNIMOD:39 | name | Methylthio | def | "Beta-methylthiolation." [RESID:AA0320, PMID:8844851, URL:http\://www.trc-canada.com/white_papers.lasso, RESID:AA0232, URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, RESID:AA0101, FindMod:BMTH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=39] | synonym | "Methyl methanethiosulfonate MMTS" [] | xref | record_id "39" | xref | delta_mono_mass "45.987721" | xref | delta_avge_mass "46.0916" | xref | delta_composition "H(2) C S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2011-11-24 16:48:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "0" | xref | spec_3_site "C" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Multiple" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N-term" | xref | spec_4_position "Any N-term" | xref | spec_4_classification "Artefact" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "K" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:40] === UNIMOD:40 Sulfo |
null .Term [UNIMOD:40] [cols="2*"] |
| id | UNIMOD:40 | name | Sulfo | def | "O-Sulfonation." [RESID:AA0172, PMID:14752058, RESID:AA0362, FindMod:SULF, RESID:AA0171, RESID:AA0361, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=40] | xref | record_id "40" | xref | delta_mono_mass "79.956815" | xref | delta_avge_mass "80.0632" | xref | delta_composition "O(3) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2012-02-14 17:50:32" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_misc_notes "Because the modification is quantitatively lost on CID, site assigment is not possible when there is a choice of sites" | xref | spec_1_neutral_loss_80_mono_mass "79.956815" | xref | spec_1_neutral_loss_80_avge_mass "80.0632" | xref | spec_1_neutral_loss_80_flag "false" | xref | spec_1_neutral_loss_80_composition "O(3) S" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_misc_notes "Because the modification is quantitatively lost on CID, site assigment is not possible when there is a choice of sites" | xref | spec_1_neutral_loss_80_mono_mass "79.956815" | xref | spec_1_neutral_loss_80_avge_mass "80.0632" | xref | spec_1_neutral_loss_80_flag "false" | xref | spec_1_neutral_loss_80_composition "O(3) S" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_misc_notes "Because the modification is quantitatively lost on CID, site assigment is not possible when there is a choice of sites" | xref | spec_1_neutral_loss_80_mono_mass "79.956815" | xref | spec_1_neutral_loss_80_avge_mass "80.0632" | xref | spec_1_neutral_loss_80_flag "false" | xref | spec_1_neutral_loss_80_composition "O(3) S" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_2_misc_notes "Sulfitolysis" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:41] === UNIMOD:41 Hex |
null .Term [UNIMOD:41] [cols="2*"] |
| id | UNIMOD:41 | name | Hex | def | "Hexose." [RESID:AA0217, RESID:AA0152, PMID:15279557, FindMod:GLUC, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&mode=exact, RESID:AA0157, FindMod:CMAN, RESID:AA0327, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=41] | synonym | "Fructose Mannose Galactose Glucose" [] | xref | record_id "41" | xref | delta_mono_mass "162.052824" | xref | delta_avge_mass "162.1406" | xref | delta_composition "Hex" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2018-06-27 13:23:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | xref | spec_1_misc_notes "glycation" | xref | spec_1_neutral_loss_55_mono_mass "54.031694" | xref | spec_1_neutral_loss_55_avge_mass "54.0458" | xref | spec_1_neutral_loss_55_flag "false" | xref | spec_1_neutral_loss_55_composition "H(6) O(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | xref | spec_1_misc_notes "glycation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_55_mono_mass "54.031694" | xref | spec_1_neutral_loss_55_avge_mass "54.0458" | xref | spec_1_neutral_loss_55_flag "false" | xref | spec_1_neutral_loss_55_composition "H(6) O(3)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_163_mono_mass "162.052824" | xref | spec_2_neutral_loss_163_avge_mass "162.1406" | xref | spec_2_neutral_loss_163_flag "false" | xref | spec_2_neutral_loss_163_composition "Hex" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Other glycosylation" | xref | spec_3_misc_notes "glycation" | xref | spec_3_neutral_loss_0_mono_mass "0" | xref | spec_3_neutral_loss_0_avge_mass "0" | xref | spec_3_neutral_loss_0_flag "false" | xref | spec_3_neutral_loss_0_composition "0" | xref | spec_3_neutral_loss_55_mono_mass "54.031694" | xref | spec_3_neutral_loss_55_avge_mass "54.0458" | xref | spec_3_neutral_loss_55_flag "false" | xref | spec_3_neutral_loss_55_composition "H(6) O(3)" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "T" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "O-linked glycosylation" | xref | spec_4_neutral_loss_163_mono_mass "162.052824" | xref | spec_4_neutral_loss_163_avge_mass "162.1406" | xref | spec_4_neutral_loss_163_flag "false" | xref | spec_4_neutral_loss_163_composition "Hex" | xref | spec_4_neutral_loss_0_mono_mass "0" | xref | spec_4_neutral_loss_0_avge_mass "0" | xref | spec_4_neutral_loss_0_flag "false" | xref | spec_4_neutral_loss_0_composition "0" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "O-linked glycosylation" | xref | spec_4_neutral_loss_163_mono_mass "162.052824" | xref | spec_4_neutral_loss_163_avge_mass "162.1406" | xref | spec_4_neutral_loss_163_flag "false" | xref | spec_4_neutral_loss_163_composition "Hex" | xref | spec_4_neutral_loss_0_mono_mass "0" | xref | spec_4_neutral_loss_0_avge_mass "0" | xref | spec_4_neutral_loss_0_flag "false" | xref | spec_4_neutral_loss_0_composition "0" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "W" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Other glycosylation" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "C" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Other glycosylation" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "Y" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "O-linked glycosylation" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:42] === UNIMOD:42 Lipoyl |
null .Term [UNIMOD:42] [cols="2*"] |
| id | UNIMOD:42 | name | Lipoyl | def | "Lipoyl." [RESID:AA0118, FindMod:LIPY, PMID:3522581, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=42] | comment | This group is normally a substituent on N6 of a lysine residue of an enzyme or other protein. | xref | record_id "42" | xref | delta_mono_mass "188.032956" | xref | delta_avge_mass "188.3103" | xref | delta_composition "H(12) C(8) O S(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 15:06:53" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:43] === UNIMOD:43 HexNAc |
null .Term [UNIMOD:43] [cols="2*"] |
| id | UNIMOD:43 | name | HexNAc | def | "N-Acetylhexosamine." [RESID:AA0151, FindMod:GLCN, RESID:AA0155, PMID:3086323, RESID:AA0154, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=43] | comment | The amine derivative of a hexose formed by replacing a hydroxyl group with an amino group.(+acetyl group). | xref | record_id "43" | xref | delta_mono_mass "203.079373" | xref | delta_avge_mass "203.1925" | xref | delta_composition "HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2017-03-30 14:45:58" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_204_mono_mass "203.079373" | xref | spec_1_neutral_loss_204_avge_mass "203.1925" | xref | spec_1_neutral_loss_204_flag "false" | xref | spec_1_neutral_loss_204_composition "HexNAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_204_mono_mass "203.079373" | xref | spec_2_neutral_loss_204_avge_mass "203.1925" | xref | spec_2_neutral_loss_204_flag "false" | xref | spec_2_neutral_loss_204_composition "HexNAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_204_mono_mass "203.079373" | xref | spec_2_neutral_loss_204_avge_mass "203.1925" | xref | spec_2_neutral_loss_204_flag "false" | xref | spec_2_neutral_loss_204_composition "HexNAc" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "C" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Other glycosylation" | xref | spec_3_neutral_loss_204_mono_mass "203.079373" | xref | spec_3_neutral_loss_204_avge_mass "203.1925" | xref | spec_3_neutral_loss_204_flag "false" | xref | spec_3_neutral_loss_204_composition "HexNAc" | xref | spec_3_neutral_loss_0_mono_mass "0" | xref | spec_3_neutral_loss_0_avge_mass "0" | xref | spec_3_neutral_loss_0_flag "false" | xref | spec_3_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:44] === UNIMOD:44 Farnesyl |
null .Term [UNIMOD:44] [cols="2*"] |
| id | UNIMOD:44 | name | Farnesyl | def | "Farnesylation." [PMID:15609361, RESID:AA0102, FindMod:FARN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=44] | xref | record_id "44" | xref | delta_mono_mass "204.187801" | xref | delta_avge_mass "204.3511" | xref | delta_composition "H(24) C(15)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 15:11:38" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:45] === UNIMOD:45 Myristoyl |
null .Term [UNIMOD:45] [cols="2*"] |
| id | UNIMOD:45 | name | Myristoyl | def | "Myristoylation." [RESID:AA0059, RESID:AA0307, RESID:AA0078, FindMod:MYRI, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=45] | xref | record_id "45" | xref | delta_mono_mass "210.198366" | xref | delta_avge_mass "210.3556" | xref | delta_composition "H(26) C(14) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 15:13:17" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "C" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:46] === UNIMOD:46 PyridoxalPhosphate |
null .Term [UNIMOD:46] [cols="2*"] |
| id | UNIMOD:46 | name | PyridoxalPhosphate | def | "Pyridoxal phosphate." [RESID:AA0119, FindMod:PLP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=46] | comment | The co-enzyme derivative of vitamin B6. Forms Schiff's bases of substrate amino acids during catalysis of transamination, decarboxylation and racemisation reactions. | xref | record_id "46" | xref | delta_mono_mass "229.014009" | xref | delta_avge_mass "229.1266" | xref | delta_composition "H(8) C(8) N O(5) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 15:35:42" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:47] === UNIMOD:47 Palmitoyl |
null .Term [UNIMOD:47] [cols="2*"] |
| id | UNIMOD:47 | name | Palmitoyl | def | "Palmitoylation." [RESID:AA0080, RESID:AA0079, RESID:AA0106, RESID:AA0077, FindMod:PALM, RESID:AA0339, RESID:AA0060, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=47] | comment | Palmitoylation is a post-translational modification that consists in the addition of a 16 carbons fatty acid, palmitate, to a cysteine residue through the creation of a thioester link. | xref | record_id "47" | xref | delta_mono_mass "238.229666" | xref | delta_avge_mass "238.4088" | xref | delta_composition "H(30) C(16) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 15:38:43" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "S" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "T" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "N-term" | xref | spec_5_position "Protein N-term" | xref | spec_5_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:48] === UNIMOD:48 GeranylGeranyl |
null .Term [UNIMOD:48] [cols="2*"] |
| id | UNIMOD:48 | name | GeranylGeranyl | def | "Geranyl-geranyl." [RESID:AA0104, PMID:15609361, FindMod:GERA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=48] | xref | record_id "48" | xref | delta_mono_mass "272.250401" | xref | delta_avge_mass "272.4681" | xref | delta_composition "H(32) C(20)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 15:47:48" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:49] === UNIMOD:49 Phosphopantetheine |
null .Term [UNIMOD:49] [cols="2*"] |
| id | UNIMOD:49 | name | Phosphopantetheine | def | "Phosphopantetheine." [RESID:AA0150, FindMod:PPAN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=49] | comment | Protein which contains at least one phosphopantetheine as the prosthetic group. In acyl carrier proteins (ACP) for example, it serves as a \'swinging arm\' for the attachment of activated fatty acid and amino-acid groups. | xref | record_id "49" | xref | delta_mono_mass "340.085794" | xref | delta_avge_mass "340.333" | xref | delta_composition "H(21) C(11) N(2) O(6) P S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 16:00:24" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:50] === UNIMOD:50 FAD |
null .Term [UNIMOD:50] [cols="2*"] |
| id | UNIMOD:50 | name | FAD | def | "Flavin adenine dinucleotide." [RESID:AA0143, URL:http\://www.aw-bc.com/mathews/EF/FAD.GIF, RESID:AA0144, RESID:AA0145, RESID:AA0221, FindMod:FAD, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=50] | xref | record_id "50" | xref | delta_mono_mass "783.141486" | xref | delta_avge_mass "783.5339" | xref | delta_composition "H(31) C(27) N(9) O(15) P(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-16 17:16:18" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:51] === UNIMOD:51 Tripalmitate |
null .Term [UNIMOD:51] [cols="2*"] |
| id | UNIMOD:51 | name | Tripalmitate | def | "N-acyl diglyceride cysteine." [PMID:10356335, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=51] | xref | record_id "51" | xref | delta_mono_mass "788.725777" | xref | delta_avge_mass "789.3049" | xref | delta_composition "H(96) C(51) O(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2006-10-18 11:47:54" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:52] === UNIMOD:52 Guanidinyl |
null .Term [UNIMOD:52] [cols="2*"] |
| id | UNIMOD:52 | name | Guanidinyl | def | "Guanidination." [PMID:11821862, URL:http\://www.indiana.edu/~reillyjp/ASMS2001posters/beardsley_poster.pdf, PMID:11078590, PMID:11085420, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=52] | comment | Specific for sidechain of lysine. Does not modify the N-termini except for glycine at a slower rate than the side chain of lysine. | synonym | "homoarginine" [] | xref | record_id "52" | xref | delta_mono_mass "42.021798" | xref | delta_avge_mass "42.04" | xref | delta_composition "H(2) C N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2011-11-21 13:56:40" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:53] === UNIMOD:53 HNE |
null .Term [UNIMOD:53] [cols="2*"] |
| id | UNIMOD:53 | name | HNE | def | "4-hydroxynonenal (HNE)." [PMID:11327326, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=53] | comment | A lipid-type modification. HNE forms a Michael addition product on Cysteine, Histidine and Lysines. Unusually, it doesn't replace a hydrogen on the amino acid side chain. | xref | record_id "53" | xref | delta_mono_mass "156.11503" | xref | delta_avge_mass "156.2221" | xref | delta_composition "H(16) C(9) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-08-19 19:17:11" | xref | date_time_modified "2012-03-09 11:21:00" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "A" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_4_misc_notes "GFAP from human brain tissues" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "L" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Post-translational" | xref | spec_5_misc_notes "GFAP from human brain tissues" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:54] === UNIMOD:54 Glucuronyl |
null .Term [UNIMOD:54] [cols="2*"] |
| id | UNIMOD:54 | name | Glucuronyl | def | "Hexuronic acid." [PMID:7398618, RESID:AA0291, RESID:AA0058, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=54] | comment | The addition of a sugar unit to a protein amino acid, e.g. the addition of glycan chains to proteins. Addition of glucuronic acid. Observed for N-term G. | synonym | "glucuronosyl" [] | xref | record_id "54" | xref | delta_mono_mass "176.032088" | xref | delta_avge_mass "176.1241" | xref | delta_composition "HexA" | xref | username_of_poster "jcottrell" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-01 21:36:48" | xref | date_time_modified "2017-11-16 14:51:01" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Other glycosylation" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_177_mono_mass "176.032088" | xref | spec_2_neutral_loss_177_avge_mass "176.1241" | xref | spec_2_neutral_loss_177_flag "false" | xref | spec_2_neutral_loss_177_composition "HexA" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_177_mono_mass "176.032088" | xref | spec_2_neutral_loss_177_avge_mass "176.1241" | xref | spec_2_neutral_loss_177_flag "false" | xref | spec_2_neutral_loss_177_composition "HexA" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:55] === UNIMOD:55 Glutathione |
null .Term [UNIMOD:55] [cols="2*"] |
| id | UNIMOD:55 | name | Glutathione | def | "Glutathione disulfide." [PMID:3083866, PMID:8344916, RESID:AA0229, FindMod:GLUT, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=55] | xref | record_id "55" | xref | delta_mono_mass "305.068156" | xref | delta_avge_mass "305.3076" | xref | delta_composition "H(15) C(10) N(3) O(6) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2002-10-03 09:10:19" | xref | date_time_modified "2006-10-16 15:51:52" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:56] === UNIMOD:56 Acetyl:2H(3) |
null .Term [UNIMOD:56] [cols="2*"] |
| id | UNIMOD:56 | name | Acetyl:2H(3) | def | "Acetate labeling reagent (N-term & K) (heavy form, +3amu)." [PMID:11857757, PMID:11999733, PMID:12175151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=56] | synonym | "N-trideuteriumacetoxy" [] | xref | record_id "56" | xref | delta_mono_mass "45.029395" | xref | delta_avge_mass "45.0552" | xref | delta_composition "H(-1) 2H(3) C(2) O" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 16:41:56" | xref | date_time_modified "2011-11-21 10:07:03" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "H" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "N-term" | xref | spec_7_position "Protein N-term" | xref | spec_7_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:58] === UNIMOD:58 Propionyl |
null .Term [UNIMOD:58] [cols="2*"] |
| id | UNIMOD:58 | name | Propionyl | def | "Propionate labeling reagent light form (N-term & K)." [PMID:12175151, PMID:11999733, PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=58] | xref | record_id "58" | xref | delta_mono_mass "56.026215" | xref | delta_avge_mass "56.0633" | xref | delta_composition "H(4) C(3) O" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 16:52:38" | xref | date_time_modified "2011-11-25 11:01:23" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "S" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "T" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "N-term" | xref | spec_5_position "Protein N-term" | xref | spec_5_classification "Multiple" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:59] === UNIMOD:59 Propionyl:13C(3) |
null .Term [UNIMOD:59] [cols="2*"] |
| id | UNIMOD:59 | name | Propionyl:13C(3) | def | "Propionate labeling reagent heavy form (+3amu), N-term & K." [PMID:11857757, PMID:12175151, PMID:11999733, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=59] | xref | record_id "59" | xref | delta_mono_mass "59.036279" | xref | delta_avge_mass "59.0412" | xref | delta_composition "H(4) 13C(3) O" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 16:55:47" | xref | date_time_modified "2006-10-16 10:27:21" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:60] === UNIMOD:60 GIST-Quat |
null .Term [UNIMOD:60] [cols="2*"] |
| id | UNIMOD:60 | name | GIST-Quat | def | "Quaternary amine labeling reagent light form (N-term & K)." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=60] | synonym | "N-(4-trimethylammoniumbutanoxy)-NHS" [] | xref | record_id "60" | xref | delta_mono_mass "127.099714" | xref | delta_avge_mass "127.1842" | xref | delta_composition "H(13) C(7) N O" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 17:02:37" | xref | date_time_modified "2006-10-16 13:39:27" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_neutral_loss_60_mono_mass "59.073499" | xref | spec_1_neutral_loss_60_avge_mass "59.1103" | xref | spec_1_neutral_loss_60_flag "false" | xref | spec_1_neutral_loss_60_composition "H(9) C(3) N" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_neutral_loss_60_mono_mass "59.073499" | xref | spec_2_neutral_loss_60_avge_mass "59.1103" | xref | spec_2_neutral_loss_60_flag "false" | xref | spec_2_neutral_loss_60_composition "H(9) C(3) N" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:61] === UNIMOD:61 GIST-Quat:2H(3) |
null .Term [UNIMOD:61] [cols="2*"] |
| id | UNIMOD:61 | name | GIST-Quat:2H(3) | def | "Quaternary amine labeling reagent heavy (+3amu) form, N-term & K." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=61] | xref | record_id "61" | xref | delta_mono_mass "130.118544" | xref | delta_avge_mass "130.2027" | xref | delta_composition "H(10) 2H(3) C(7) N O" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 17:09:34" | xref | date_time_modified "2006-10-16 13:40:03" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_neutral_loss_63_mono_mass "62.09233" | xref | spec_1_neutral_loss_63_avge_mass "62.1287" | xref | spec_1_neutral_loss_63_flag "false" | xref | spec_1_neutral_loss_63_composition "H(6) 2H(3) C(3) N" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_neutral_loss_63_mono_mass "62.09233" | xref | spec_2_neutral_loss_63_avge_mass "62.1287" | xref | spec_2_neutral_loss_63_flag "false" | xref | spec_2_neutral_loss_63_composition "H(6) 2H(3) C(3) N" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:62] === UNIMOD:62 GIST-Quat:2H(6) |
null .Term [UNIMOD:62] [cols="2*"] |
| id | UNIMOD:62 | name | GIST-Quat:2H(6) | def | "Quaternary amine labeling reagent heavy form (+6amu), N-term & K." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=62] | xref | record_id "62" | xref | delta_mono_mass "133.137375" | xref | delta_avge_mass "133.2212" | xref | delta_composition "H(7) 2H(6) C(7) N O" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 17:12:27" | xref | date_time_modified "2006-10-16 13:40:56" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_neutral_loss_66_mono_mass "65.11116" | xref | spec_1_neutral_loss_66_avge_mass "65.1472" | xref | spec_1_neutral_loss_66_flag "false" | xref | spec_1_neutral_loss_66_composition "H(3) 2H(6) C(3) N" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_neutral_loss_66_mono_mass "65.11116" | xref | spec_2_neutral_loss_66_avge_mass "65.1472" | xref | spec_2_neutral_loss_66_flag "false" | xref | spec_2_neutral_loss_66_composition "H(3) 2H(6) C(3) N" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:63] === UNIMOD:63 GIST-Quat:2H(9) |
null .Term [UNIMOD:63] [cols="2*"] |
| id | UNIMOD:63 | name | GIST-Quat:2H(9) | def | "Quaternary amine labeling reagent heavy form (+9amu), N-term & K." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=63] | xref | record_id "63" | xref | delta_mono_mass "136.156205" | xref | delta_avge_mass "136.2397" | xref | delta_composition "H(4) 2H(9) C(7) N O" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 17:14:22" | xref | date_time_modified "2006-10-16 13:41:45" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_neutral_loss_69_mono_mass "68.12999" | xref | spec_1_neutral_loss_69_avge_mass "68.1657" | xref | spec_1_neutral_loss_69_flag "false" | xref | spec_1_neutral_loss_69_composition "2H(9) C(3) N" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_neutral_loss_69_mono_mass "68.12999" | xref | spec_2_neutral_loss_69_avge_mass "68.1657" | xref | spec_2_neutral_loss_69_flag "false" | xref | spec_2_neutral_loss_69_composition "2H(9) C(3) N" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:64] === UNIMOD:64 Succinyl |
null .Term [UNIMOD:64] [cols="2*"] |
| id | UNIMOD:64 | name | Succinyl | def | "Succinic anhydride labeling reagent light form (N-term & K)." [PMID:12175151, PMID:11857757, RESID:AA0130, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=64] | xref | record_id "64" | xref | delta_mono_mass "100.016044" | xref | delta_avge_mass "100.0728" | xref | delta_composition "H(4) C(4) O(3)" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 17:17:07" | xref | date_time_modified "2006-10-16 12:40:39" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:65] === UNIMOD:65 Succinyl:2H(4) |
null .Term [UNIMOD:65] [cols="2*"] |
| id | UNIMOD:65 | name | Succinyl:2H(4) | def | "Succinic anhydride labeling reagent, heavy form (+4amu, 4H2), N-term & K." [PMID:11857757, PMID:12175151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=65] | xref | record_id "65" | xref | delta_mono_mass "104.041151" | xref | delta_avge_mass "104.0974" | xref | delta_composition "2H(4) C(4) O(3)" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 17:19:51" | xref | date_time_modified "2006-10-16 12:42:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:66] === UNIMOD:66 Succinyl:13C(4) |
null .Term [UNIMOD:66] [cols="2*"] |
| id | UNIMOD:66 | name | Succinyl:13C(4) | def | "Succinic anhydride labeling reagent, heavy form (+4amu, 4C13), N-term & K." [PMID:11857757, PMID:12175151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=66] | xref | record_id "66" | xref | delta_mono_mass "104.029463" | xref | delta_avge_mass "104.0434" | xref | delta_composition "H(4) 13C(4) O(3)" | xref | username_of_poster "penner" | xref | group_of_poster "users" | xref | date_time_posted "2002-10-16 17:23:58" | xref | date_time_modified "2006-10-16 12:41:49" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:89] === UNIMOD:89 Iminobiotin |
null .Term [UNIMOD:89] [cols="2*"] |
| id | UNIMOD:89 | name | Iminobiotin | def | "Iminobiotinylation." [PMID:9750125, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=89] | xref | record_id "89" | xref | delta_mono_mass "225.093583" | xref | delta_avge_mass "225.3106" | xref | delta_composition "H(15) C(10) N(3) O S" | xref | username_of_poster "toppolzer" | xref | group_of_poster "users" | xref | date_time_posted "2002-11-25 16:01:48" | xref | date_time_modified "2006-10-16 15:26:37" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:90] === UNIMOD:90 ESP |
null .Term [UNIMOD:90] [cols="2*"] |
| id | UNIMOD:90 | name | ESP | def | "ESP-Tag light d0." [URL:http\://www.wzw.tum.de/proteomik/forum2003/Posters-Abstracts.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=90] | xref | record_id "90" | xref | delta_mono_mass "338.177647" | xref | delta_avge_mass "338.4682" | xref | delta_composition "H(26) C(16) N(4) O(2) S" | xref | username_of_poster "toppolzer" | xref | group_of_poster "users" | xref | date_time_posted "2002-11-25 16:12:50" | xref | date_time_modified "2006-10-16 15:58:19" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:91] === UNIMOD:91 ESP:2H(10) |
null .Term [UNIMOD:91] [cols="2*"] |
| id | UNIMOD:91 | name | ESP:2H(10) | def | "ESP-Tag heavy d10." [URL:http\://www.wzw.tum.de/proteomik/forum2003/Posters-Abstracts.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=91] | xref | record_id "91" | xref | delta_mono_mass "348.240414" | xref | delta_avge_mass "348.5299" | xref | delta_composition "H(16) 2H(10) C(16) N(4) O(2) S" | xref | username_of_poster "toppolzer" | xref | group_of_poster "users" | xref | date_time_posted "2002-11-25 16:18:58" | xref | date_time_modified "2006-10-16 16:03:06" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:92] === UNIMOD:92 NHS-LC-Biotin |
null .Term [UNIMOD:92] [cols="2*"] |
| id | UNIMOD:92 | name | NHS-LC-Biotin | def | "NHS-LC-Biotin." [URL:http\://pubs.acs.org/doi/abs/10.1021/bi062142x, URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=8D38BA83-EFDC-421A-853F-E96EBA380612, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=92] | synonym | "N-biotinyl-6-aminohexanoyl" [] | xref | record_id "92" | xref | delta_mono_mass "339.161662" | xref | delta_avge_mass "339.453" | xref | delta_composition "H(25) C(16) N(3) O(3) S" | xref | username_of_poster "toppolzer" | xref | group_of_poster "users" | xref | date_time_posted "2002-12-04 09:55:19" | xref | date_time_modified "2015-05-07 10:57:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:93] === UNIMOD:93 EDT-maleimide-PEO-biotin |
null .Term [UNIMOD:93] [cols="2*"] |
| id | UNIMOD:93 | name | EDT-maleimide-PEO-biotin | def | "EDT-maleimide-PEO-biotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031005, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=93] | xref | record_id "93" | xref | delta_mono_mass "601.206246" | xref | delta_avge_mass "601.8021" | xref | delta_composition "H(39) C(25) N(5) O(6) S(3)" | xref | username_of_poster "take" | xref | group_of_poster "users" | xref | date_time_posted "2002-12-27 09:08:56" | xref | date_time_modified "2006-11-14 11:15:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:94] === UNIMOD:94 IMID |
null .Term [UNIMOD:94] [cols="2*"] |
| id | UNIMOD:94 | name | IMID | def | "IMID d0." [PMID:11746907, URL:http\://www.chem.agilent.com/cag/lystag.asp, URL:http\://www.chem.agilent.com/cag/other/IMTHUPO2003.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=94] | synonym | "2-methoxy-4,5-dihydro-1H-imidazole derivative Lys imidazole" [] | xref | record_id "94" | xref | delta_mono_mass "68.037448" | xref | delta_avge_mass "68.0773" | xref | delta_composition "H(4) C(3) N(2)" | xref | username_of_poster "Liao" | xref | group_of_poster "users" | xref | date_time_posted "2003-01-09 04:14:06" | xref | date_time_modified "2006-10-16 10:33:45" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:95] === UNIMOD:95 IMID:2H(4) |
null .Term [UNIMOD:95] [cols="2*"] |
| id | UNIMOD:95 | name | IMID:2H(4) | def | "IMID d4." [URL:http\://www.chem.agilent.com/cag/lystag.asp, PMID:11746907, URL:http\://www.chem.agilent.com/cag/other/IMTHUPO2003.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=95] | synonym | "2-methoxy-4,5-dihydro-1H-imidazole derivative" [] | xref | record_id "95" | xref | delta_mono_mass "72.062555" | xref | delta_avge_mass "72.1019" | xref | delta_composition "2H(4) C(3) N(2)" | xref | username_of_poster "Liao" | xref | group_of_poster "users" | xref | date_time_posted "2003-01-09 04:15:25" | xref | date_time_modified "2006-10-16 11:06:13" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:97] === UNIMOD:97 Propionamide:2H(3) |
null .Term [UNIMOD:97] [cols="2*"] |
| id | UNIMOD:97 | name | Propionamide:2H(3) | def | "Acrylamide d3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=97] | xref | record_id "97" | xref | delta_mono_mass "74.055944" | xref | delta_avge_mass "74.0964" | xref | delta_composition "H(2) 2H(3) C(3) N O" | xref | username_of_poster "Liao" | xref | group_of_poster "users" | xref | date_time_posted "2003-01-14 08:10:30" | xref | date_time_modified "2006-10-16 11:07:07" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:105] === UNIMOD:105 ICAT-C |
null .Term [UNIMOD:105] [cols="2*"] |
| id | UNIMOD:105 | name | ICAT-C | def | "Applied Biosystems cleavable ICAT™ light." [URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/icat.htm, URL:https\://products.appliedbiosystems.com/ab/en/US/adirect/ab?cmd=catNavigate2&catID=600902, URL:http\://docs.appliedbiosystems.com/pebiodocs/04333373.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=105] | xref | record_id "105" | xref | delta_mono_mass "227.126991" | xref | delta_avge_mass "227.2603" | xref | delta_composition "H(17) C(10) N(3) O(3)" | xref | username_of_poster "tpjd2" | xref | group_of_poster "users" | xref | date_time_posted "2003-01-27 10:27:11" | xref | date_time_modified "2006-10-16 15:32:17" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:106] === UNIMOD:106 ICAT-C:13C(9) |
null .Term [UNIMOD:106] [cols="2*"] |
| id | UNIMOD:106 | name | ICAT-C:13C(9) | def | "Applied Biosystems cleavable ICAT™ heavy." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04333373.pdf, URL:https\://products.appliedbiosystems.com/ab/en/US/adirect/ab?cmd=catNavigate2&catID=600902, URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/icat.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=106] | xref | record_id "106" | xref | delta_mono_mass "236.157185" | xref | delta_avge_mass "236.1942" | xref | delta_composition "H(17) C 13C(9) N(3) O(3)" | xref | username_of_poster "tpjd2" | xref | group_of_poster "users" | xref | date_time_posted "2003-01-27 10:32:53" | xref | date_time_modified "2006-10-16 15:34:14" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:107] === UNIMOD:107 FormylMet |
null .Term [UNIMOD:107] [cols="2*"] |
| id | UNIMOD:107 | name | FormylMet | def | "Addition of N-formyl met." [RESID:AA0021, PMID:10825024, PMID:8758896, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=107] | xref | record_id "107" | xref | delta_mono_mass "159.035399" | xref | delta_avge_mass "159.2062" | xref | delta_composition "H(9) C(6) N O(2) S" | xref | username_of_poster "jphilip" | xref | group_of_poster "users" | xref | date_time_posted "2003-01-27 18:24:14" | xref | date_time_modified "2006-10-16 14:08:15" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Pre-translational" | xref | spec_1_misc_notes "only with Listeria monocytogenes (gram-positive bacteria)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:108] === UNIMOD:108 Nethylmaleimide |
null .Term [UNIMOD:108] [cols="2*"] |
| id | UNIMOD:108 | name | Nethylmaleimide | def | "N-ethylmaleimide on cysteines." [URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:12777388, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=108] | synonym | "CysNEM" [] | xref | record_id "108" | xref | delta_mono_mass "125.047679" | xref | delta_avge_mass "125.1253" | xref | delta_composition "H(7) C(6) N O(2)" | xref | username_of_poster "Pflieger" | xref | group_of_poster "users" | xref | date_time_posted "2003-01-30 09:52:51" | xref | date_time_modified "2006-10-16 13:36:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:112] === UNIMOD:112 OxLysBiotinRed |
null .Term [UNIMOD:112] [cols="2*"] |
| id | UNIMOD:112 | name | OxLysBiotinRed | def | "Oxidized lysine biotinylated with biotin-LC-hydrazide, reduced." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=112] | xref | record_id "112" | xref | delta_mono_mass "354.172562" | xref | delta_avge_mass "354.4676" | xref | delta_composition "H(26) C(16) N(4) O(3) S" | xref | username_of_poster "S_Lee" | xref | group_of_poster "users" | xref | date_time_posted "2003-02-21 00:53:43" | xref | date_time_modified "2006-11-14 12:10:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:113] === UNIMOD:113 OxLysBiotin |
null .Term [UNIMOD:113] [cols="2*"] |
| id | UNIMOD:113 | name | OxLysBiotin | def | "Oxidized lysine biotinylated with biotin-LC-hydrazide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=113] | xref | record_id "113" | xref | delta_mono_mass "352.156911" | xref | delta_avge_mass "352.4518" | xref | delta_composition "H(24) C(16) N(4) O(3) S" | xref | username_of_poster "S_Lee" | xref | group_of_poster "users" | xref | date_time_posted "2003-02-21 01:25:11" | xref | date_time_modified "2006-11-14 12:10:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:114] === UNIMOD:114 OxProBiotinRed |
null .Term [UNIMOD:114] [cols="2*"] |
| id | UNIMOD:114 | name | OxProBiotinRed | def | "Oxidized proline biotinylated with biotin-LC-hydrazide, reduced." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=114] | xref | record_id "114" | xref | delta_mono_mass "371.199111" | xref | delta_avge_mass "371.4982" | xref | delta_composition "H(29) C(16) N(5) O(3) S" | xref | username_of_poster "S_Lee" | xref | group_of_poster "users" | xref | date_time_posted "2003-02-21 01:34:28" | xref | date_time_modified "2006-11-14 12:11:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:115] === UNIMOD:115 OxProBiotin |
null .Term [UNIMOD:115] [cols="2*"] |
| id | UNIMOD:115 | name | OxProBiotin | def | "Oxidized Proline biotinylated with biotin-LC-hydrazide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=115] | xref | record_id "115" | xref | delta_mono_mass "369.183461" | xref | delta_avge_mass "369.4823" | xref | delta_composition "H(27) C(16) N(5) O(3) S" | xref | username_of_poster "S_Lee" | xref | group_of_poster "users" | xref | date_time_posted "2003-02-21 01:35:44" | xref | date_time_modified "2006-11-14 12:11:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:116] === UNIMOD:116 OxArgBiotin |
null .Term [UNIMOD:116] [cols="2*"] |
| id | UNIMOD:116 | name | OxArgBiotin | def | "Oxidized arginine biotinylated with biotin-LC-hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, URL:http\://themedicalbiochemistrypage.org/nitrogen-metabolism.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=116] | xref | record_id "116" | xref | delta_mono_mass "310.135113" | xref | delta_avge_mass "310.4118" | xref | delta_composition "H(22) C(15) N(2) O(3) S" | xref | username_of_poster "S_Lee" | xref | group_of_poster "users" | xref | date_time_posted "2003-02-21 01:41:19" | xref | date_time_modified "2011-07-18 11:34:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:117] === UNIMOD:117 OxArgBiotinRed |
null .Term [UNIMOD:117] [cols="2*"] |
| id | UNIMOD:117 | name | OxArgBiotinRed | def | "Oxidized arginine biotinylated with biotin-LC-hydrazide, reduced." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, URL:http\://themedicalbiochemistrypage.org/nitrogen-metabolism.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=117] | xref | record_id "117" | xref | delta_mono_mass "312.150763" | xref | delta_avge_mass "312.4277" | xref | delta_composition "H(24) C(15) N(2) O(3) S" | xref | username_of_poster "S_Lee" | xref | group_of_poster "users" | xref | date_time_posted "2003-02-21 01:43:00" | xref | date_time_modified "2011-07-18 11:33:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:118] === UNIMOD:118 EDT-iodoacetyl-PEO-biotin |
null .Term [UNIMOD:118] [cols="2*"] |
| id | UNIMOD:118 | name | EDT-iodoacetyl-PEO-biotin | def | "EDT-iodo-PEO-biotin." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=118] | xref | record_id "118" | xref | delta_mono_mass "490.174218" | xref | delta_avge_mass "490.7034" | xref | delta_composition "H(34) C(20) N(4) O(4) S(3)" | xref | username_of_poster "take" | xref | group_of_poster "users" | xref | date_time_posted "2003-02-24 07:18:42" | xref | date_time_modified "2006-10-16 17:01:15" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:119] === UNIMOD:119 IBTP |
null .Term [UNIMOD:119] [cols="2*"] |
| id | UNIMOD:119 | name | IBTP | def | "Thio Ether Formation - BTP Adduct." [PMID:11861642, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=119] | xref | record_id "119" | xref | delta_mono_mass "316.138088" | xref | delta_avge_mass "316.3759" | xref | delta_composition "H(21) C(22) P" | xref | username_of_poster "MRCDunn" | xref | group_of_poster "users" | xref | date_time_posted "2003-03-13 09:36:40" | xref | date_time_modified "2006-10-16 15:52:42" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:121] === UNIMOD:121 GG |
null .Term [UNIMOD:121] [cols="2*"] |
| id | UNIMOD:121 | name | GG | def | "Ubiquitinylation residue." [PMID:12872131, URL:http\://www.nottingham.ac.uk/biochemcourses/students/ub/ubindex.html, PMID:15055197, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=121] | comment | The two glycine residues left on ubiquitinylated lysine after tryptic digestion. | synonym | "glycineglycine" [] | xref | record_id "121" | xref | delta_mono_mass "114.042927" | xref | delta_avge_mass "114.1026" | xref | delta_composition "H(6) C(4) N(2) O(2)" | xref | username_of_poster "gielbert" | xref | group_of_poster "users" | xref | date_time_posted "2003-04-30 13:32:37" | xref | date_time_modified "2017-03-06 08:47:05" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Other" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "C" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Other" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "N-term" | xref | spec_5_position "Protein N-term" | xref | spec_5_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:122] === UNIMOD:122 Formyl |
null .Term [UNIMOD:122] [cols="2*"] |
| id | UNIMOD:122 | name | Formyl | def | "Formylation." [RESID:AA0211, PMID:15799070, RESID:AA0021, FindMod:FORM, RESID:AA0384, RESID:AA0057, RESID:AA0384, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=122] | xref | record_id "122" | xref | delta_mono_mass "27.994915" | xref | delta_avge_mass "28.0101" | xref | delta_composition "C O" | xref | username_of_poster "pnacman" | xref | group_of_poster "users" | xref | date_time_posted "2003-05-01 13:28:36" | xref | date_time_modified "2006-11-14 12:01:57" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Artefact" | xref | spec_2_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "S" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Artefact" | xref | spec_3_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "T" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Artefact" | xref | spec_4_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)" | xref | spec_5_group "5" | xref | spec_5_hidden "0" | xref | spec_5_site "N-term" | xref | spec_5_position "Protein N-term" | xref | spec_5_classification "Post-translational" | xref | spec_5_misc_notes "A protein in which either the N-terminal N-formylmethionine has not been processed by the methionyl-tRNA formyltransferase or which is posttranslationally modified by the attachment of at least one formyl group." | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:123] === UNIMOD:123 ICAT-H |
null .Term [UNIMOD:123] [cols="2*"] |
| id | UNIMOD:123 | name | ICAT-H | def | "N-iodoacetyl, p-chlorobenzyl-12C6-glucamine." [PMID:12185208, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=123] | synonym | "Harbury glyco-ICAT C12" [] | xref | record_id "123" | xref | delta_mono_mass "345.097915" | xref | delta_avge_mass "345.7754" | xref | delta_composition "H(20) C(15) N O(6) Cl" | xref | username_of_poster "allis" | xref | group_of_poster "users" | xref | date_time_posted "2003-05-07 19:54:20" | xref | date_time_modified "2006-10-16 16:02:00" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:124] === UNIMOD:124 ICAT-H:13C(6) |
null .Term [UNIMOD:124] [cols="2*"] |
| id | UNIMOD:124 | name | ICAT-H:13C(6) | def | "N-iodoacetyl, p-chlorobenzyl-13C6-glucamine." [PMID:12185208, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=124] | synonym | "Harbury glyco-ICAT C13" [] | xref | record_id "124" | xref | delta_mono_mass "351.118044" | xref | delta_avge_mass "351.7313" | xref | delta_composition "H(20) C(9) 13C(6) N O(6) Cl" | xref | username_of_poster "allis" | xref | group_of_poster "users" | xref | date_time_posted "2003-05-07 19:56:12" | xref | date_time_modified "2006-10-16 16:04:02" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:126] === UNIMOD:126 X88 |
null .Term [UNIMOD:126] [cols="2*"] |
| id | UNIMOD:126 | name | X88 | def | "Cleaved and reduced DSP/DTSSP crosslinker." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011280_DTSSP_DSP_UG.pdf, PMID:322714, PMID:3155470, PMID:957432, PMID:8457554, PMID:11710128, PMID:1262347, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=126] | comment | Can also be the product of reaction with EZ-Link Sulfo-NHS-SS-Biotin (Sulfosuccinimidyl 2-(biotinamido)-ethyl-1, 3-dithiopropionate) followed by reduction with DTT. | synonym | "(Was Thioacyl)" [] | xref | record_id "126" | xref | delta_mono_mass "87.998285" | xref | delta_avge_mass "88.1283" | xref | delta_composition "H(4) C(3) O S" | xref | username_of_poster "rabah" | xref | group_of_poster "users" | xref | date_time_posted "2003-06-05 13:38:19" | xref | date_time_modified "2017-08-18 17:03:05" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:127] === UNIMOD:127 Fluoro |
null .Term [UNIMOD:127] [cols="2*"] |
| id | UNIMOD:127 | name | Fluoro | def | "Fluorination." [PMID:1093385, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=127] | xref | record_id "127" | xref | delta_mono_mass "17.990578" | xref | delta_avge_mass "17.9905" | xref | delta_composition "H(-1) F" | xref | username_of_poster "jschulte" | xref | group_of_poster "users" | xref | date_time_posted "2003-06-19 19:54:25" | xref | date_time_modified "2012-11-20 11:56:44" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Non-standard residue" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "W" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Non-standard residue" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Non-standard residue" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "A" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:128] === UNIMOD:128 Fluorescein |
null .Term [UNIMOD:128] [cols="2*"] |
| id | UNIMOD:128 | name | Fluorescein | def | "5-Iodoacetamidofluorescein (Molecular Probe, Eugene, OR)." [PMID:3578767, PMID:3311742, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=128] | xref | record_id "128" | xref | delta_mono_mass "387.074287" | xref | delta_avge_mass "387.3417" | xref | delta_composition "H(13) C(22) N O(6)" | xref | username_of_poster "Philip" | xref | group_of_poster "users" | xref | date_time_posted "2003-06-25 02:58:18" | xref | date_time_modified "2017-11-01 12:11:48" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:129] === UNIMOD:129 Iodo |
null .Term [UNIMOD:129] [cols="2*"] |
| id | UNIMOD:129 | name | Iodo | def | "Iodination." [PMID:2026710, PMID:15627961, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=129] | xref | record_id "129" | xref | delta_mono_mass "125.896648" | xref | delta_avge_mass "125.8965" | xref | delta_composition "H(-1) I" | xref | username_of_poster "brettsp" | xref | group_of_poster "users" | xref | date_time_posted "2003-07-10 15:43:17" | xref | date_time_modified "2006-10-16 13:38:03" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:130] === UNIMOD:130 Diiodo |
null .Term [UNIMOD:130] [cols="2*"] |
| id | UNIMOD:130 | name | Diiodo | def | "Di-Iodination." [PMID:15627961, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=130] | xref | record_id "130" | xref | delta_mono_mass "251.793296" | xref | delta_avge_mass "251.7931" | xref | delta_composition "H(-2) I(2)" | xref | username_of_poster "brettsp" | xref | group_of_poster "users" | xref | date_time_posted "2003-07-10 15:49:42" | xref | date_time_modified "2011-11-21 13:23:20" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:131] === UNIMOD:131 Triiodo |
null .Term [UNIMOD:131] [cols="2*"] |
| id | UNIMOD:131 | name | Triiodo | def | "Tri-Iodination." [PMID:2026710, PMID:15627961, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=131] | xref | record_id "131" | xref | delta_mono_mass "377.689944" | xref | delta_avge_mass "377.6896" | xref | delta_composition "H(-3) I(3)" | xref | username_of_poster "brettsp" | xref | group_of_poster "users" | xref | date_time_posted "2003-07-10 15:51:32" | xref | date_time_modified "2006-10-16 16:36:49" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:134] === UNIMOD:134 Myristoleyl |
null .Term [UNIMOD:134] [cols="2*"] |
| id | UNIMOD:134 | name | Myristoleyl | def | "(cis-delta 5)-tetradecaenoyl." [PMID:1326520, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=134] | comment | Found on vision signal transduction proteins. | synonym | "myristoyl with one double bond C14:1 acylation" [] | xref | record_id "134" | xref | delta_mono_mass "208.182715" | xref | delta_avge_mass "208.3398" | xref | delta_composition "H(24) C(14) O" | xref | username_of_poster "tomneubert" | xref | group_of_poster "users" | xref | date_time_posted "2003-07-18 21:30:51" | xref | date_time_modified "2006-10-16 15:11:18" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Co-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:135] === UNIMOD:135 Myristoyl+Delta:H(-4) |
null .Term [UNIMOD:135] [cols="2*"] |
| id | UNIMOD:135 | name | Myristoyl+Delta:H(-4) | def | "(cis,cis-delta 5, delta 8)-tetradecadienoyl." [PMID:1326520, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=135] | comment | Found on vision signal transduction proteins. | synonym | "myristoyl with 2 double bonds C14:2 fatty acylation" [] | xref | record_id "135" | xref | delta_mono_mass "206.167065" | xref | delta_avge_mass "206.3239" | xref | delta_composition "H(22) C(14) O" | xref | username_of_poster "tomneubert" | xref | group_of_poster "users" | xref | date_time_posted "2003-07-18 21:36:44" | xref | date_time_modified "2006-10-16 15:10:51" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Co-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:136] === UNIMOD:136 Benzoyl |
null .Term [UNIMOD:136] [cols="2*"] |
| id | UNIMOD:136 | name | Benzoyl | def | "Labeling reagent light form (N-term & K)." [PMID:15456300, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=136] | xref | record_id "136" | xref | delta_mono_mass "104.026215" | xref | delta_avge_mass "104.1061" | xref | delta_composition "H(4) C(7) O" | xref | username_of_poster "samirjulka" | xref | group_of_poster "users" | xref | date_time_posted "2003-07-31 22:24:05" | xref | date_time_modified "2006-10-16 12:41:22" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:137] === UNIMOD:137 Hex(5)HexNAc(2) |
null .Term [UNIMOD:137] [cols="2*"] |
| id | UNIMOD:137 | name | Hex(5)HexNAc(2) | def | "N-linked glycan core." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=137] | comment | Core structure of high-mannose N-linked oligosaccharides. | synonym | "Man5" [] | xref | record_id "137" | xref | delta_mono_mass "1216.422863" | xref | delta_avge_mass "1217.088" | xref | delta_composition "Hex(5) HexNAc(2)" | xref | username_of_poster "tpjd2" | xref | group_of_poster "users" | xref | date_time_posted "2003-08-06 11:31:37" | xref | date_time_modified "2015-05-01 15:44:36" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1217_mono_mass "1216.422863" | xref | spec_1_neutral_loss_1217_avge_mass "1217.088" | xref | spec_1_neutral_loss_1217_flag "false" | xref | spec_1_neutral_loss_1217_composition "Hex(5) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:139] === UNIMOD:139 Dansyl |
null .Term [UNIMOD:139] [cols="2*"] |
| id | UNIMOD:139 | name | Dansyl | def | "5-dimethylaminonaphthalene-1-sulfonyl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=139] | xref | record_id "139" | xref | delta_mono_mass "233.051049" | xref | delta_avge_mass "233.2862" | xref | delta_composition "H(11) C(12) N O(2) S" | xref | username_of_poster "allis" | xref | group_of_poster "users" | xref | date_time_posted "2003-08-19 02:51:24" | xref | date_time_modified "2006-10-16 15:36:09" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:140] === UNIMOD:140 a-type-ion |
null .Term [UNIMOD:140] [cols="2*"] |
| id | UNIMOD:140 | name | a-type-ion | def | "ISD a-series (C-Term)." [PMID:14588022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=140] | comment | MS/MS experiments of mass spectrometric a-ions (MS^3) can be used for protein identification by library searching. T3-sequencing is such a technique (see reference). Search engines must recognize this \'virtual modification\' for this purpose. | synonym | "Decarboxylation of C-terminus as reaction inside the mass spectrometer" [] | xref | record_id "140" | xref | delta_mono_mass "-46.005479" | xref | delta_avge_mass "-46.0254" | xref | delta_composition "H(-2) C(-1) O(-2)" | xref | username_of_poster "suckau" | xref | group_of_poster "users" | xref | date_time_posted "2003-09-02 16:17:09" | xref | date_time_modified "2010-06-08 14:19:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "Virtual Modification for MS/MS of a-type ions corrected by subtraction of a further -O at 8.6.2010" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:141] === UNIMOD:141 Amidine |
null .Term [UNIMOD:141] [cols="2*"] |
| id | UNIMOD:141 | name | Amidine | def | "Amidination of lysines or N-terminal amines with methyl acetimidate." [URL:http\://www.indiana.edu/~reillyjp/ASMS2004/janecki_Ext-Abs%20Amidination.pdf, PMID:12643539, PMID:6273432, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=141] | xref | record_id "141" | xref | delta_mono_mass "41.026549" | xref | delta_avge_mass "41.0519" | xref | delta_composition "H(3) C(2) N" | xref | username_of_poster "pnacman" | xref | group_of_poster "users" | xref | date_time_posted "2003-09-25 11:04:41" | xref | date_time_modified "2006-10-15 18:32:25" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:142] === UNIMOD:142 HexNAc(1)dHex(1) |
null .Term [UNIMOD:142] [cols="2*"] |
| id | UNIMOD:142 | name | HexNAc(1)dHex(1) | def | "HexNAc1dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=142] | xref | record_id "142" | xref | delta_mono_mass "349.137281" | xref | delta_avge_mass "349.3337" | xref | delta_composition "dHex HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:28:45" | xref | date_time_modified "2015-05-05 10:49:49" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_350_mono_mass "349.137281" | xref | spec_1_neutral_loss_350_avge_mass "349.3337" | xref | spec_1_neutral_loss_350_flag "false" | xref | spec_1_neutral_loss_350_composition "dHex HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_350_mono_mass "349.137281" | xref | spec_2_neutral_loss_350_avge_mass "349.3337" | xref | spec_2_neutral_loss_350_flag "false" | xref | spec_2_neutral_loss_350_composition "dHex HexNAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_350_mono_mass "349.137281" | xref | spec_2_neutral_loss_350_avge_mass "349.3337" | xref | spec_2_neutral_loss_350_flag "false" | xref | spec_2_neutral_loss_350_composition "dHex HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:143] === UNIMOD:143 HexNAc(2) |
null .Term [UNIMOD:143] [cols="2*"] |
| id | UNIMOD:143 | name | HexNAc(2) | def | "HexNAc2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=143] | xref | record_id "143" | xref | delta_mono_mass "406.158745" | xref | delta_avge_mass "406.385" | xref | delta_composition "HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:37:55" | xref | date_time_modified "2015-05-05 10:50:08" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_407_mono_mass "406.158745" | xref | spec_1_neutral_loss_407_avge_mass "406.385" | xref | spec_1_neutral_loss_407_flag "false" | xref | spec_1_neutral_loss_407_composition "HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_407_mono_mass "406.158745" | xref | spec_2_neutral_loss_407_avge_mass "406.385" | xref | spec_2_neutral_loss_407_flag "false" | xref | spec_2_neutral_loss_407_composition "HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_407_mono_mass "406.158745" | xref | spec_2_neutral_loss_407_avge_mass "406.385" | xref | spec_2_neutral_loss_407_flag "false" | xref | spec_2_neutral_loss_407_composition "HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:144] === UNIMOD:144 Hex(3) |
null .Term [UNIMOD:144] [cols="2*"] |
| id | UNIMOD:144 | name | Hex(3) | def | "Hex3." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=144] | xref | record_id "144" | xref | delta_mono_mass "486.158471" | xref | delta_avge_mass "486.4218" | xref | delta_composition "Hex(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:39:30" | xref | date_time_modified "2015-05-05 10:52:04" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_487_mono_mass "486.158471" | xref | spec_1_neutral_loss_487_avge_mass "486.4218" | xref | spec_1_neutral_loss_487_flag "false" | xref | spec_1_neutral_loss_487_composition "Hex(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_487_mono_mass "486.158471" | xref | spec_2_neutral_loss_487_avge_mass "486.4218" | xref | spec_2_neutral_loss_487_flag "false" | xref | spec_2_neutral_loss_487_composition "Hex(3)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_487_mono_mass "486.158471" | xref | spec_2_neutral_loss_487_avge_mass "486.4218" | xref | spec_2_neutral_loss_487_flag "false" | xref | spec_2_neutral_loss_487_composition "Hex(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:145] === UNIMOD:145 HexNAc(1)dHex(2) |
null .Term [UNIMOD:145] [cols="2*"] |
| id | UNIMOD:145 | name | HexNAc(1)dHex(2) | def | "HexNAc1dHex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=145] | xref | record_id "145" | xref | delta_mono_mass "495.19519" | xref | delta_avge_mass "495.4749" | xref | delta_composition "dHex(2) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:40:57" | xref | date_time_modified "2015-05-01 15:19:51" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_496_mono_mass "495.19519" | xref | spec_1_neutral_loss_496_avge_mass "495.4749" | xref | spec_1_neutral_loss_496_flag "false" | xref | spec_1_neutral_loss_496_composition "dHex(2) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:146] === UNIMOD:146 Hex(1)HexNAc(1)dHex(1) |
null .Term [UNIMOD:146] [cols="2*"] |
| id | UNIMOD:146 | name | Hex(1)HexNAc(1)dHex(1) | def | "Hex1HexNAc1dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=146] | xref | record_id "146" | xref | delta_mono_mass "511.190105" | xref | delta_avge_mass "511.4743" | xref | delta_composition "dHex Hex HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:42:27" | xref | date_time_modified "2015-05-05 10:52:59" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_512_mono_mass "511.190105" | xref | spec_1_neutral_loss_512_avge_mass "511.4743" | xref | spec_1_neutral_loss_512_flag "false" | xref | spec_1_neutral_loss_512_composition "dHex Hex HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_512_mono_mass "511.190105" | xref | spec_2_neutral_loss_512_avge_mass "511.4743" | xref | spec_2_neutral_loss_512_flag "false" | xref | spec_2_neutral_loss_512_composition "dHex Hex HexNAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_512_mono_mass "511.190105" | xref | spec_2_neutral_loss_512_avge_mass "511.4743" | xref | spec_2_neutral_loss_512_flag "false" | xref | spec_2_neutral_loss_512_composition "dHex Hex HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:147] === UNIMOD:147 HexNAc(2)dHex(1) |
null .Term [UNIMOD:147] [cols="2*"] |
| id | UNIMOD:147 | name | HexNAc(2)dHex(1) | def | "HexNAc2dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=147] | xref | record_id "147" | xref | delta_mono_mass "552.216654" | xref | delta_avge_mass "552.5262" | xref | delta_composition "dHex HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:44:18" | xref | date_time_modified "2015-05-01 15:23:32" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_553_mono_mass "552.216654" | xref | spec_1_neutral_loss_553_avge_mass "552.5262" | xref | spec_1_neutral_loss_553_flag "false" | xref | spec_1_neutral_loss_553_composition "dHex HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:148] === UNIMOD:148 Hex(1)HexNAc(2) |
null .Term [UNIMOD:148] [cols="2*"] |
| id | UNIMOD:148 | name | Hex(1)HexNAc(2) | def | "Hex1HexNAc2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=148] | xref | record_id "148" | xref | delta_mono_mass "568.211569" | xref | delta_avge_mass "568.5256" | xref | delta_composition "Hex HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:48:18" | xref | date_time_modified "2015-05-05 10:46:08" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_569_mono_mass "568.211569" | xref | spec_1_neutral_loss_569_avge_mass "568.5256" | xref | spec_1_neutral_loss_569_flag "false" | xref | spec_1_neutral_loss_569_composition "Hex HexNAc(2)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_569_mono_mass "568.211569" | xref | spec_2_neutral_loss_569_avge_mass "568.5256" | xref | spec_2_neutral_loss_569_flag "false" | xref | spec_2_neutral_loss_569_composition "Hex HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_569_mono_mass "568.211569" | xref | spec_2_neutral_loss_569_avge_mass "568.5256" | xref | spec_2_neutral_loss_569_flag "false" | xref | spec_2_neutral_loss_569_composition "Hex HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:149] === UNIMOD:149 Hex(1)HexNAc(1)NeuAc(1) |
null .Term [UNIMOD:149] [cols="2*"] |
| id | UNIMOD:149 | name | Hex(1)HexNAc(1)NeuAc(1) | def | "Hex1HexNAc1NeuAc1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=149] | xref | record_id "149" | xref | delta_mono_mass "656.227613" | xref | delta_avge_mass "656.5877" | xref | delta_composition "Hex HexNAc NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:51:19" | xref | date_time_modified "2015-05-01 15:25:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_657_mono_mass "656.227613" | xref | spec_1_neutral_loss_657_avge_mass "656.5877" | xref | spec_1_neutral_loss_657_flag "false" | xref | spec_1_neutral_loss_657_composition "Hex HexNAc NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_657_mono_mass "656.227613" | xref | spec_2_neutral_loss_657_avge_mass "656.5877" | xref | spec_2_neutral_loss_657_flag "false" | xref | spec_2_neutral_loss_657_composition "Hex HexNAc NeuAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_657_mono_mass "656.227613" | xref | spec_2_neutral_loss_657_avge_mass "656.5877" | xref | spec_2_neutral_loss_657_flag "false" | xref | spec_2_neutral_loss_657_composition "Hex HexNAc NeuAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:150] === UNIMOD:150 HexNAc(2)dHex(2) |
null .Term [UNIMOD:150] [cols="2*"] |
| id | UNIMOD:150 | name | HexNAc(2)dHex(2) | def | "HexNAc2dHex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=150] | xref | record_id "150" | xref | delta_mono_mass "698.274563" | xref | delta_avge_mass "698.6674" | xref | delta_composition "dHex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:52:36" | xref | date_time_modified "2015-05-01 15:25:48" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_699_mono_mass "698.274563" | xref | spec_1_neutral_loss_699_avge_mass "698.6674" | xref | spec_1_neutral_loss_699_flag "false" | xref | spec_1_neutral_loss_699_composition "dHex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:151] === UNIMOD:151 Hex(1)HexNAc(2)Pent(1) |
null .Term [UNIMOD:151] [cols="2*"] |
| id | UNIMOD:151 | name | Hex(1)HexNAc(2)Pent(1) | def | "Hex1HexNAc2Pent1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=151] | xref | record_id "151" | xref | delta_mono_mass "700.253828" | xref | delta_avge_mass "700.6403" | xref | delta_composition "Pent Hex HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:53:29" | xref | date_time_modified "2015-05-01 15:26:17" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_701_mono_mass "700.253828" | xref | spec_1_neutral_loss_701_avge_mass "700.6403" | xref | spec_1_neutral_loss_701_flag "false" | xref | spec_1_neutral_loss_701_composition "Pent Hex HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:152] === UNIMOD:152 Hex(1)HexNAc(2)dHex(1) |
null .Term [UNIMOD:152] [cols="2*"] |
| id | UNIMOD:152 | name | Hex(1)HexNAc(2)dHex(1) | def | "Hex1HexNAc2dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=152] | xref | record_id "152" | xref | delta_mono_mass "714.269478" | xref | delta_avge_mass "714.6668" | xref | delta_composition "dHex Hex HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:54:18" | xref | date_time_modified "2015-05-05 16:20:33" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_715_mono_mass "714.269478" | xref | spec_1_neutral_loss_715_avge_mass "714.6668" | xref | spec_1_neutral_loss_715_flag "false" | xref | spec_1_neutral_loss_715_composition "dHex Hex HexNAc(2)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_715_mono_mass "714.269478" | xref | spec_2_neutral_loss_715_avge_mass "714.6668" | xref | spec_2_neutral_loss_715_flag "false" | xref | spec_2_neutral_loss_715_composition "dHex Hex HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_715_mono_mass "714.269478" | xref | spec_2_neutral_loss_715_avge_mass "714.6668" | xref | spec_2_neutral_loss_715_flag "false" | xref | spec_2_neutral_loss_715_composition "dHex Hex HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:153] === UNIMOD:153 Hex(2)HexNAc(2) |
null .Term [UNIMOD:153] [cols="2*"] |
| id | UNIMOD:153 | name | Hex(2)HexNAc(2) | def | "Hex2HexNAc2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=153] | xref | record_id "153" | xref | delta_mono_mass "730.264392" | xref | delta_avge_mass "730.6662" | xref | delta_composition "Hex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:55:08" | xref | date_time_modified "2015-05-05 16:22:13" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_731_mono_mass "730.264392" | xref | spec_1_neutral_loss_731_avge_mass "730.6662" | xref | spec_1_neutral_loss_731_flag "false" | xref | spec_1_neutral_loss_731_composition "Hex(2) HexNAc(2)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_731_mono_mass "730.264392" | xref | spec_2_neutral_loss_731_avge_mass "730.6662" | xref | spec_2_neutral_loss_731_flag "false" | xref | spec_2_neutral_loss_731_composition "Hex(2) HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_731_mono_mass "730.264392" | xref | spec_2_neutral_loss_731_avge_mass "730.6662" | xref | spec_2_neutral_loss_731_flag "false" | xref | spec_2_neutral_loss_731_composition "Hex(2) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:154] === UNIMOD:154 Hex(3)HexNAc(1)Pent(1) |
null .Term [UNIMOD:154] [cols="2*"] |
| id | UNIMOD:154 | name | Hex(3)HexNAc(1)Pent(1) | def | "Hex3HexNAc1Pent1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=154] | xref | record_id "154" | xref | delta_mono_mass "821.280102" | xref | delta_avge_mass "821.7289" | xref | delta_composition "Pent Hex(3) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:56:02" | xref | date_time_modified "2015-05-01 15:29:31" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_822_mono_mass "821.280102" | xref | spec_1_neutral_loss_822_avge_mass "821.7289" | xref | spec_1_neutral_loss_822_flag "false" | xref | spec_1_neutral_loss_822_composition "Pent Hex(3) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:155] === UNIMOD:155 Hex(1)HexNAc(2)dHex(1)Pent(1) |
null .Term [UNIMOD:155] [cols="2*"] |
| id | UNIMOD:155 | name | Hex(1)HexNAc(2)dHex(1)Pent(1) | def | "Hex1HexNAc2dHex1Pent1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&dhex=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=155] | xref | record_id "155" | xref | delta_mono_mass "846.311736" | xref | delta_avge_mass "846.7815" | xref | delta_composition "Pent dHex Hex HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:57:01" | xref | date_time_modified "2015-05-01 15:29:55" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_847_mono_mass "846.311736" | xref | spec_1_neutral_loss_847_avge_mass "846.7815" | xref | spec_1_neutral_loss_847_flag "false" | xref | spec_1_neutral_loss_847_composition "Pent dHex Hex HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:156] === UNIMOD:156 Hex(1)HexNAc(2)dHex(2) |
null .Term [UNIMOD:156] [cols="2*"] |
| id | UNIMOD:156 | name | Hex(1)HexNAc(2)dHex(2) | def | "Hex1HexNAc2dHex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=156] | xref | record_id "156" | xref | delta_mono_mass "860.327386" | xref | delta_avge_mass "860.808" | xref | delta_composition "dHex(2) Hex HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:57:52" | xref | date_time_modified "2015-05-05 16:24:22" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_861_mono_mass "860.327386" | xref | spec_1_neutral_loss_861_avge_mass "860.808" | xref | spec_1_neutral_loss_861_flag "false" | xref | spec_1_neutral_loss_861_composition "dHex(2) Hex HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_861_mono_mass "860.327386" | xref | spec_2_neutral_loss_861_avge_mass "860.808" | xref | spec_2_neutral_loss_861_flag "false" | xref | spec_2_neutral_loss_861_composition "dHex(2) Hex HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_861_mono_mass "860.327386" | xref | spec_2_neutral_loss_861_avge_mass "860.808" | xref | spec_2_neutral_loss_861_flag "false" | xref | spec_2_neutral_loss_861_composition "dHex(2) Hex HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:157] === UNIMOD:157 Hex(2)HexNAc(2)Pent(1) |
null .Term [UNIMOD:157] [cols="2*"] |
| id | UNIMOD:157 | name | Hex(2)HexNAc(2)Pent(1) | def | "Hex2HexNAc2Pent1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=157] | xref | record_id "157" | xref | delta_mono_mass "862.306651" | xref | delta_avge_mass "862.7809" | xref | delta_composition "Pent Hex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:58:38" | xref | date_time_modified "2015-05-01 15:30:54" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_863_mono_mass "862.306651" | xref | spec_1_neutral_loss_863_avge_mass "862.7809" | xref | spec_1_neutral_loss_863_flag "false" | xref | spec_1_neutral_loss_863_composition "Pent Hex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:158] === UNIMOD:158 Hex(2)HexNAc(2)dHex(1) |
null .Term [UNIMOD:158] [cols="2*"] |
| id | UNIMOD:158 | name | Hex(2)HexNAc(2)dHex(1) | def | "Hex2HexNAc2dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=158] | xref | record_id "158" | xref | delta_mono_mass "876.322301" | xref | delta_avge_mass "876.8074" | xref | delta_composition "dHex Hex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:59:18" | xref | date_time_modified "2015-05-05 16:26:14" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_877_mono_mass "876.322301" | xref | spec_1_neutral_loss_877_avge_mass "876.8074" | xref | spec_1_neutral_loss_877_flag "false" | xref | spec_1_neutral_loss_877_composition "dHex Hex(2) HexNAc(2)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_877_mono_mass "876.322301" | xref | spec_2_neutral_loss_877_avge_mass "876.8074" | xref | spec_2_neutral_loss_877_flag "false" | xref | spec_2_neutral_loss_877_composition "dHex Hex(2) HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_877_mono_mass "876.322301" | xref | spec_2_neutral_loss_877_avge_mass "876.8074" | xref | spec_2_neutral_loss_877_flag "false" | xref | spec_2_neutral_loss_877_composition "dHex Hex(2) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:159] === UNIMOD:159 Hex(3)HexNAc(2) |
null .Term [UNIMOD:159] [cols="2*"] |
| id | UNIMOD:159 | name | Hex(3)HexNAc(2) | def | "Hex3HexNAc2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=159] | synonym | "chitobiose core" [] | xref | record_id "159" | xref | delta_mono_mass "892.317216" | xref | delta_avge_mass "892.8068" | xref | delta_composition "Hex(3) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 12:59:59" | xref | date_time_modified "2015-05-05 16:27:36" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_893_mono_mass "892.317216" | xref | spec_1_neutral_loss_893_avge_mass "892.8068" | xref | spec_1_neutral_loss_893_flag "false" | xref | spec_1_neutral_loss_893_composition "Hex(3) HexNAc(2)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_893_mono_mass "892.317216" | xref | spec_2_neutral_loss_893_avge_mass "892.8068" | xref | spec_2_neutral_loss_893_flag "false" | xref | spec_2_neutral_loss_893_composition "Hex(3) HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_893_mono_mass "892.317216" | xref | spec_2_neutral_loss_893_avge_mass "892.8068" | xref | spec_2_neutral_loss_893_flag "false" | xref | spec_2_neutral_loss_893_composition "Hex(3) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:160] === UNIMOD:160 Hex(1)HexNAc(1)NeuAc(2) |
null .Term [UNIMOD:160] [cols="2*"] |
| id | UNIMOD:160 | name | Hex(1)HexNAc(1)NeuAc(2) | def | "Hex HexNAc NeuAc(2) ---OR--- Hex HexNAc(3) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=160] | xref | record_id "160" | xref | delta_mono_mass "947.323029" | xref | delta_avge_mass "947.8423" | xref | delta_composition "Hex HexNAc NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 13:01:06" | xref | date_time_modified "2017-11-17 11:43:49" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_948_mono_mass "947.323029" | xref | spec_1_neutral_loss_948_avge_mass "947.8423" | xref | spec_1_neutral_loss_948_flag "false" | xref | spec_1_neutral_loss_948_composition "Hex HexNAc NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_948_mono_mass "947.323029" | xref | spec_2_neutral_loss_948_avge_mass "947.8423" | xref | spec_2_neutral_loss_948_flag "false" | xref | spec_2_neutral_loss_948_composition "Hex HexNAc NeuAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_948_mono_mass "947.323029" | xref | spec_2_neutral_loss_948_avge_mass "947.8423" | xref | spec_2_neutral_loss_948_flag "false" | xref | spec_2_neutral_loss_948_composition "Hex HexNAc NeuAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:161] === UNIMOD:161 Hex(3)HexNAc(2)Phos(1) |
null .Term [UNIMOD:161] [cols="2*"] |
| id | UNIMOD:161 | name | Hex(3)HexNAc(2)Phos(1) | def | "Hex(3) HexNAc(2) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=161] | xref | record_id "161" | xref | delta_mono_mass "972.283547" | xref | delta_avge_mass "972.7867" | xref | delta_composition "H O(3) P Hex(3) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2003-09-29 13:02:02" | xref | date_time_modified "2015-05-06 09:48:32" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_973_mono_mass "972.283547" | xref | spec_1_neutral_loss_973_avge_mass "972.7867" | xref | spec_1_neutral_loss_973_flag "false" | xref | spec_1_neutral_loss_973_composition "H O(3) P Hex(3) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:162] === UNIMOD:162 Delta:S(-1)Se(1) |
null .Term [UNIMOD:162] [cols="2*"] |
| id | UNIMOD:162 | name | Delta:S(-1)Se(1) | def | "Selenium replaces sulfur." [RESID:AA0022, PMID:12148805, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=162] | xref | record_id "162" | xref | delta_mono_mass "47.944449" | xref | delta_avge_mass "46.895" | xref | delta_composition "S(-1) Se" | xref | username_of_poster "pnacman" | xref | group_of_poster "users" | xref | date_time_posted "2003-10-14 11:24:28" | xref | date_time_modified "2012-03-09 11:23:23" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Non-standard residue" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Non-standard residue" | xref | spec_2_misc_notes "Selenocysteine conventionally represented by 1 letter code U" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:170] === UNIMOD:170 Delta:H(1)N(-1)18O(1) |
null .Term [UNIMOD:170] [cols="2*"] |
| id | UNIMOD:170 | name | Delta:H(1)N(-1)18O(1) | def | "Glycosylated asparagine 18O labeling." [PMID:1443554, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=170] | comment | Conversion of glycosylated asparagine residues upon deglycosylation with PGNase F in 18O labelled water. | xref | record_id "170" | xref | delta_mono_mass "2.988261" | xref | delta_avge_mass "2.9845" | xref | delta_composition "H(-1) N(-1) 18O" | xref | username_of_poster "lobvi" | xref | group_of_poster "users" | xref | date_time_posted "2003-12-11 18:24:58" | xref | date_time_modified "2014-05-21 08:59:48" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:171] === UNIMOD:171 NBS:13C(6) |
null .Term [UNIMOD:171] [cols="2*"] |
| id | UNIMOD:171 | name | NBS:13C(6) | def | "Shimadzu NBS-13C." [PMID:12845591, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=171] | synonym | "NBS reagent heavy" [] | xref | record_id "171" | xref | delta_mono_mass "159.008578" | xref | delta_avge_mass "159.1144" | xref | delta_composition "H(3) 13C(6) N O(2) S" | xref | username_of_poster "kuyama" | xref | group_of_poster "users" | xref | date_time_posted "2004-01-07 07:22:34" | xref | date_time_modified "2007-08-31 10:35:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:172] === UNIMOD:172 NBS |
null .Term [UNIMOD:172] [cols="2*"] |
| id | UNIMOD:172 | name | NBS | def | "Shimadzu NBS-12C." [PMID:12845591, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=172] | synonym | "2-nitrobenzenesulfenyl" [] | xref | record_id "172" | xref | delta_mono_mass "152.988449" | xref | delta_avge_mass "153.1585" | xref | delta_composition "H(3) C(6) N O(2) S" | xref | username_of_poster "kuyama" | xref | group_of_poster "users" | xref | date_time_posted "2004-01-07 07:25:07" | xref | date_time_modified "2007-08-31 10:34:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:176] === UNIMOD:176 BHT |
null .Term [UNIMOD:176] [cols="2*"] |
| id | UNIMOD:176 | name | BHT | def | "Michael addition of BHT quinone methide to Cysteine and Lysine." [PMID:9448752, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=176] | comment | BHT metabolism has been studied in rats and mice in relation to tumor promotion. | synonym | "Butylated Hydroxytoluene" [] | xref | record_id "176" | xref | delta_mono_mass "218.167065" | xref | delta_avge_mass "218.3346" | xref | delta_composition "H(22) C(15) O" | xref | username_of_poster "gonzo" | xref | group_of_poster "users" | xref | date_time_posted "2004-02-05 22:02:53" | xref | date_time_modified "2006-10-16 15:19:41" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "Secondary adduct - much less common as C" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_2_misc_notes "Secondary adduct - much less common as C" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "C" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Other" | xref | spec_3_misc_notes "Primary adduct formed" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:178] === UNIMOD:178 DAET |
null .Term [UNIMOD:178] [cols="2*"] |
| id | UNIMOD:178 | name | DAET | def | "Phosphorylation to amine thiol." [PMID:12216740, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=178] | comment | DAET = 2-(dimethylamino)ethanethiol; The phosphorylation to amine is the beta elimination of phosphate and Michael addition of 2-(dimethylamino)ethanethiol to the site. | synonym | "b-elimination thiol derivatization" [] | xref | record_id "178" | xref | delta_mono_mass "87.050655" | xref | delta_avge_mass "87.1866" | xref | delta_composition "H(9) C(4) N O(-1) S" | xref | username_of_poster "chemgirl18" | xref | group_of_poster "users" | xref | date_time_posted "2004-02-11 20:34:16" | xref | date_time_modified "2006-10-16 12:34:48" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:184] === UNIMOD:184 Label:13C(9) |
null .Term [UNIMOD:184] [cols="2*"] |
| id | UNIMOD:184 | name | Label:13C(9) | def | "13C(9) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=184] | synonym | "heavy tyrosine" [] | xref | record_id "184" | xref | delta_mono_mass "9.030193" | xref | delta_avge_mass "8.9339" | xref | delta_composition "C(-9) 13C(9)" | xref | username_of_poster "hs" | xref | group_of_poster "users" | xref | date_time_posted "2004-02-16 21:19:47" | xref | date_time_modified "2007-08-22 18:31:52" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in SILAC experiment" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "F" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:185] === UNIMOD:185 Label:13C(9)+Phospho |
null .Term [UNIMOD:185] [cols="2*"] |
| id | UNIMOD:185 | name | Label:13C(9)+Phospho | def | "C13 label (Phosphotyrosine)." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=185] | synonym | "heavy phosphotyrosine" [] | xref | record_id "185" | xref | delta_mono_mass "88.996524" | xref | delta_avge_mass "88.9138" | xref | delta_composition "H C(-9) 13C(9) O(3) P" | xref | username_of_poster "hs" | xref | group_of_poster "users" | xref | date_time_posted "2004-02-22 04:42:33" | xref | date_time_modified "2006-10-16 12:37:51" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in SILAC experiment" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:186] === UNIMOD:186 HPG |
null .Term [UNIMOD:186] [cols="2*"] |
| id | UNIMOD:186 | name | HPG | def | "Hydroxyphenylglyoxal arginine." [PMID:11698400, PMID:11914093, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=186] | synonym | "HPG arginine" [] | xref | record_id "186" | xref | delta_mono_mass "132.021129" | xref | delta_avge_mass "132.1162" | xref | delta_composition "H(4) C(8) O(2)" | xref | username_of_poster "gcarven" | xref | group_of_poster "users" | xref | date_time_posted "2004-02-26 20:19:25" | xref | date_time_modified "2006-10-17 11:46:39" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:187] === UNIMOD:187 2HPG |
null .Term [UNIMOD:187] [cols="2*"] |
| id | UNIMOD:187 | name | 2HPG | def | "Bis(hydroxphenylglyoxal) arginine." [PMID:11698400, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=187] | comment | OH-PGO and PGO react with arginine at a stoichiometry of 2:1. | xref | record_id "187" | xref | delta_mono_mass "282.052824" | xref | delta_avge_mass "282.2476" | xref | delta_composition "H(10) C(16) O(5)" | xref | username_of_poster "gcarven" | xref | group_of_poster "users" | xref | date_time_posted "2004-02-26 22:05:25" | xref | date_time_modified "2009-06-26 17:37:17" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:188] === UNIMOD:188 Label:13C(6) |
null .Term [UNIMOD:188] [cols="2*"] |
| id | UNIMOD:188 | name | Label:13C(6) | def | "13C(6) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=188] | xref | record_id "188" | xref | delta_mono_mass "6.020129" | xref | delta_avge_mass "5.9559" | xref | delta_composition "C(-6) 13C(6)" | xref | username_of_poster "hs" | xref | group_of_poster "users" | xref | date_time_posted "2004-02-28 19:54:10" | xref | date_time_modified "2007-08-22 18:29:56" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in SILAC experiment" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_2_misc_notes "Used in SILAC experiment" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "L" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Used in SILAC experiment" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "I" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_5_misc_notes "Used in SILAC experiment" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:193] === UNIMOD:193 Label:18O(2) |
null .Term [UNIMOD:193] [cols="2*"] |
| id | UNIMOD:193 | name | Label:18O(2) | def | "O18 label at both C-terminal oxygens." [PMID:11467524, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=193] | synonym | "Double O18 (C-term)" [] | xref | record_id "193" | xref | delta_mono_mass "4.008491" | xref | delta_avge_mass "3.9995" | xref | delta_composition "O(-2) 18O(2)" | xref | username_of_poster "Hensbergen" | xref | group_of_poster "users" | xref | date_time_posted "2004-03-30 14:20:29" | xref | date_time_modified "2006-11-14 12:01:04" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:194] === UNIMOD:194 AccQTag |
null .Term [UNIMOD:194] [cols="2*"] |
| id | UNIMOD:194 | name | AccQTag | def | "6-aminoquinolyl-N-hydroxysuccinimidyl carbamate." [URL:http\://www2.waters.com/watprod.nsf/newdocs/930494, PMID:14997490, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=194] | xref | record_id "194" | xref | delta_mono_mass "170.048013" | xref | delta_avge_mass "170.1674" | xref | delta_composition "H(6) C(10) N(2) O" | xref | username_of_poster "davidcreasy" | xref | group_of_poster "users" | xref | date_time_posted "2004-04-08 12:01:19" | xref | date_time_modified "2006-10-16 14:59:12" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:195] === UNIMOD:195 QAT |
null .Term [UNIMOD:195] [cols="2*"] |
| id | UNIMOD:195 | name | QAT | def | "APTA-d0." [PMID:15283597, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=195] | synonym | "(3-acrylamidopropyl)trimethylammonium" [] | xref | record_id "195" | xref | delta_mono_mass "171.149738" | xref | delta_avge_mass "171.26" | xref | delta_composition "H(19) C(9) N(2) O" | xref | username_of_poster "s_julka" | xref | group_of_poster "users" | xref | date_time_posted "2004-04-08 17:12:14" | xref | date_time_modified "2009-06-26 17:39:29" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:196] === UNIMOD:196 QAT:2H(3) |
null .Term [UNIMOD:196] [cols="2*"] |
| id | UNIMOD:196 | name | QAT:2H(3) | def | "APTA d3." [PMID:15283597, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=196] | synonym | "(3-acrylamidopropyl)trimethylammonium" [] | xref | record_id "196" | xref | delta_mono_mass "174.168569" | xref | delta_avge_mass "174.2784" | xref | delta_composition "H(16) 2H(3) C(9) N(2) O" | xref | username_of_poster "s_julka" | xref | group_of_poster "users" | xref | date_time_posted "2004-04-08 17:15:04" | xref | date_time_modified "2006-10-16 15:01:35" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:197] === UNIMOD:197 EQAT |
null .Term [UNIMOD:197] [cols="2*"] |
| id | UNIMOD:197 | name | EQAT | def | "EAPTA d0." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=197] | xref | record_id "197" | xref | delta_mono_mass "184.157563" | xref | delta_avge_mass "184.2786" | xref | delta_composition "H(20) C(10) N(2) O" | xref | username_of_poster "s_julka" | xref | group_of_poster "users" | xref | date_time_posted "2004-04-08 17:21:08" | xref | date_time_modified "2006-10-16 15:05:02" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:198] === UNIMOD:198 EQAT:2H(5) |
null .Term [UNIMOD:198] [cols="2*"] |
| id | UNIMOD:198 | name | EQAT:2H(5) | def | "EAPTA d5." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=198] | xref | record_id "198" | xref | delta_mono_mass "189.188947" | xref | delta_avge_mass "189.3094" | xref | delta_composition "H(15) 2H(5) C(10) N(2) O" | xref | username_of_poster "s_julka" | xref | group_of_poster "users" | xref | date_time_posted "2004-04-08 17:25:24" | xref | date_time_modified "2006-10-16 15:07:31" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:199] === UNIMOD:199 Dimethyl:2H(4) |
null .Term [UNIMOD:199] [cols="2*"] |
| id | UNIMOD:199 | name | Dimethyl:2H(4) | def | "DiMethyl-CHD2." [PMID:14670044, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=199] | synonym | "reductive amination" [] | xref | record_id "199" | xref | delta_mono_mass "32.056407" | xref | delta_avge_mass "32.0778" | xref | delta_composition "2H(4) C(2)" | xref | username_of_poster "PhilipHsu" | xref | group_of_poster "users" | xref | date_time_posted "2004-04-20 07:07:29" | xref | date_time_modified "2014-11-16 07:35:30" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "When dimethyl labelling is pre-digest" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "R" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:200] === UNIMOD:200 Ethanedithiol |
null .Term [UNIMOD:200] [cols="2*"] |
| id | UNIMOD:200 | name | Ethanedithiol | def | "EDT." [PMID:11507762, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=200] | xref | record_id "200" | xref | delta_mono_mass "75.980527" | xref | delta_avge_mass "76.1838" | xref | delta_composition "H(4) C(2) O(-1) S(2)" | xref | username_of_poster "take" | xref | group_of_poster "users" | xref | date_time_posted "2004-04-20 08:27:30" | xref | date_time_modified "2006-10-16 11:07:38" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:205] === UNIMOD:205 Delta:H(6)C(6)O(1) |
null .Term [UNIMOD:205] [cols="2*"] |
| id | UNIMOD:205 | name | Delta:H(6)C(6)O(1) | def | "Acrolein addition +94." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=205] | synonym | "Acrolein94, FDP" [] | xref | record_id "205" | xref | delta_mono_mass "94.041865" | xref | delta_avge_mass "94.1112" | xref | delta_composition "H(6) C(6) O" | xref | username_of_poster "fatcat" | xref | group_of_poster "users" | xref | date_time_posted "2004-05-06 18:54:17" | xref | date_time_modified "2006-10-16 12:38:28" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:206] === UNIMOD:206 Delta:H(4)C(3)O(1) |
null .Term [UNIMOD:206] [cols="2*"] |
| id | UNIMOD:206 | name | Delta:H(4)C(3)O(1) | def | "Acrolein addition +56." [PMID:15541752, PMID:10825247, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=206] | synonym | "Acrolein56" [] | xref | record_id "206" | xref | delta_mono_mass "56.026215" | xref | delta_avge_mass "56.0633" | xref | delta_composition "H(4) C(3) O" | xref | username_of_poster "fatcat" | xref | group_of_poster "users" | xref | date_time_posted "2004-05-06 18:55:58" | xref | date_time_modified "2017-11-08 16:29:48" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Other" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "R" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:207] === UNIMOD:207 Delta:H(2)C(3) |
null .Term [UNIMOD:207] [cols="2*"] |
| id | UNIMOD:207 | name | Delta:H(2)C(3) | def | "Acrolein addition +38." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=207] | synonym | "Acrolein38" [] | xref | record_id "207" | xref | delta_mono_mass "38.01565" | xref | delta_avge_mass "38.048" | xref | delta_composition "H(2) C(3)" | xref | username_of_poster "fatcat" | xref | group_of_poster "users" | xref | date_time_posted "2004-05-06 18:57:08" | xref | date_time_modified "2006-10-15 18:30:31" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:208] === UNIMOD:208 Delta:H(4)C(6) |
null .Term [UNIMOD:208] [cols="2*"] |
| id | UNIMOD:208 | name | Delta:H(4)C(6) | def | "Acrolein addition +76." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=208] | synonym | "Acrolein76" [] | xref | record_id "208" | xref | delta_mono_mass "76.0313" | xref | delta_avge_mass "76.096" | xref | delta_composition "H(4) C(6)" | xref | username_of_poster "fatcat" | xref | group_of_poster "users" | xref | date_time_posted "2004-05-06 18:59:23" | xref | date_time_modified "2006-10-16 11:08:13" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:209] === UNIMOD:209 Delta:H(8)C(6)O(2) |
null .Term [UNIMOD:209] [cols="2*"] |
| id | UNIMOD:209 | name | Delta:H(8)C(6)O(2) | def | "Acrolein addition +112." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=209] | synonym | "Acrolein112" [] | xref | record_id "209" | xref | delta_mono_mass "112.05243" | xref | delta_avge_mass "112.1265" | xref | delta_composition "H(8) C(6) O(2)" | xref | username_of_poster "fatcat" | xref | group_of_poster "users" | xref | date_time_posted "2004-05-06 19:00:25" | xref | date_time_modified "2006-10-16 12:46:03" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:211] === UNIMOD:211 NEIAA |
null .Term [UNIMOD:211] [cols="2*"] |
| id | UNIMOD:211 | name | NEIAA | def | "N-ethyl iodoacetamide-d0." [PMID:12766232, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=211] | xref | record_id "211" | xref | delta_mono_mass "85.052764" | xref | delta_avge_mass "85.1045" | xref | delta_composition "H(7) C(4) N O" | xref | username_of_poster "Botting" | xref | group_of_poster "users" | xref | date_time_posted "2004-05-18 11:10:37" | xref | date_time_modified "2006-10-16 12:15:11" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Y" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:212] === UNIMOD:212 NEIAA:2H(5) |
null .Term [UNIMOD:212] [cols="2*"] |
| id | UNIMOD:212 | name | NEIAA:2H(5) | def | "N-ethyl iodoacetamide-d5." [PMID:12766232, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=212] | xref | record_id "212" | xref | delta_mono_mass "90.084148" | xref | delta_avge_mass "90.1353" | xref | delta_composition "H(2) 2H(5) C(4) N O" | xref | username_of_poster "Botting" | xref | group_of_poster "users" | xref | date_time_posted "2004-05-18 11:11:52" | xref | date_time_modified "2006-10-16 12:38:09" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Y" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:213] === UNIMOD:213 ADP-Ribosyl |
null .Term [UNIMOD:213] [cols="2*"] |
| id | UNIMOD:213 | name | ADP-Ribosyl | def | "ADP Ribose addition." [URL:http\://betelgeuse.u-strasbg.fr/DocPARP/DocPARG/images/Structure-pADPR.jpg, PMID:15842200, RESID:AA0231, RESID:AA0237, RESID:AA0295, FindMod:ADP, RESID:AA0168, RESID:AA0169, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=213] | xref | record_id "213" | xref | delta_mono_mass "541.06111" | xref | delta_avge_mass "541.3005" | xref | delta_composition "H(13) C(10) N(5) O(9) P(2) Pent" | xref | username_of_poster "ionjockey" | xref | group_of_poster "users" | xref | date_time_posted "2004-05-27 20:53:37" | xref | date_time_modified "2017-11-23 14:29:45" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other glycosylation" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "N-linked glycosylation" | xref | spec_3_neutral_loss_0_mono_mass "0" | xref | spec_3_neutral_loss_0_avge_mass "0" | xref | spec_3_neutral_loss_0_flag "false" | xref | spec_3_neutral_loss_0_composition "0" | xref | spec_3_neutral_loss_542_mono_mass "541.06111" | xref | spec_3_neutral_loss_542_avge_mass "541.3005" | xref | spec_3_neutral_loss_542_flag "false" | xref | spec_3_neutral_loss_542_composition "H(13) C(10) N(5) O(9) P(2) Pent" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "T" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "O-linked glycosylation" | xref | spec_4_neutral_loss_542_mono_mass "541.06111" | xref | spec_4_neutral_loss_542_avge_mass "541.3005" | xref | spec_4_neutral_loss_542_flag "false" | xref | spec_4_neutral_loss_542_composition "H(13) C(10) N(5) O(9) P(2) Pent" | xref | spec_4_neutral_loss_0_mono_mass "0" | xref | spec_4_neutral_loss_0_avge_mass "0" | xref | spec_4_neutral_loss_0_flag "false" | xref | spec_4_neutral_loss_0_composition "0" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "O-linked glycosylation" | xref | spec_4_neutral_loss_0_mono_mass "0" | xref | spec_4_neutral_loss_0_avge_mass "0" | xref | spec_4_neutral_loss_0_flag "false" | xref | spec_4_neutral_loss_0_composition "0" | xref | spec_4_neutral_loss_542_mono_mass "541.06111" | xref | spec_4_neutral_loss_542_avge_mass "541.3005" | xref | spec_4_neutral_loss_542_flag "false" | xref | spec_4_neutral_loss_542_composition "H(13) C(10) N(5) O(9) P(2) Pent" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "E" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Other glycosylation" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "K" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Other glycosylation" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "D" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Other glycosylation" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:214] === UNIMOD:214 iTRAQ4plex |
null .Term [UNIMOD:214] [cols="2*"] |
| id | UNIMOD:214 | name | iTRAQ4plex | def | "Representative mass and accurate mass for 116 & 117." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=214] | comment | Different channels have the same nominal mass but slightly different exact masses. Use this value for all channels for quantitation purposes. mTRAQ heavy is identical to iTRAQ4plex 117. | synonym | "AKA iTRAQ4plex116/7 Applied Biosystems iTRAQ™ multiplexed quantitation chemistry" [] | xref | record_id "214" | xref | delta_mono_mass "144.102063" | xref | delta_avge_mass "144.1544" | xref | delta_composition "H(12) C(4) 13C(3) N 15N O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2004-06-08 14:04:07" | xref | date_time_modified "2017-11-09 09:35:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "0" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Very low abundance" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_5_misc_notes "Very low abundance" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | xref | spec_6_misc_notes "Very low abundance" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "N-term" | xref | spec_7_position "Protein N-term" | xref | spec_7_classification "Isotopic label" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "C" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Isotopic label" | xref | spec_8_misc_notes "side reaction" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:243] === UNIMOD:243 IGBP |
null .Term [UNIMOD:243] [cols="2*"] |
| id | UNIMOD:243 | name | IGBP | def | "Light IDBEST tag for quantitation." [URL:http\://www.targetdiscovery.com/index.php?topic=prod.idbe, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=243] | xref | record_id "243" | xref | delta_mono_mass "296.016039" | xref | delta_avge_mass "297.1478" | xref | delta_composition "H(13) C(12) N(2) O(2) Br" | xref | username_of_poster "zqiao" | xref | group_of_poster "users" | xref | date_time_posted "2004-07-26 23:02:04" | xref | date_time_modified "2006-10-19 11:13:26" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:253] === UNIMOD:253 Crotonaldehyde |
null .Term [UNIMOD:253] [cols="2*"] |
| id | UNIMOD:253 | name | Crotonaldehyde | def | "Crotonaldehyde." [PMID:11283024, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=253] | xref | record_id "253" | xref | delta_mono_mass "70.041865" | xref | delta_avge_mass "70.0898" | xref | delta_composition "H(6) C(4) O" | xref | username_of_poster "fatcat" | xref | group_of_poster "users" | xref | date_time_posted "2004-08-12 19:56:03" | xref | date_time_modified "2006-10-16 10:35:31" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:254] === UNIMOD:254 Delta:H(2)C(2) |
null .Term [UNIMOD:254] [cols="2*"] |
| id | UNIMOD:254 | name | Delta:H(2)C(2) | def | "Acetaldehyde +26." [PMID:7744761, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=254] | comment | Lys modification is formation of Schiff base. | xref | record_id "254" | xref | delta_mono_mass "26.01565" | xref | delta_avge_mass "26.0373" | xref | delta_composition "H(2) C(2)" | xref | username_of_poster "fatcat" | xref | group_of_poster "users" | xref | date_time_posted "2004-08-12 20:01:03" | xref | date_time_modified "2011-11-21 13:14:17" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Other" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N-term" | xref | spec_4_position "Any N-term" | xref | spec_4_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:255] === UNIMOD:255 Delta:H(4)C(2) |
null .Term [UNIMOD:255] [cols="2*"] |
| id | UNIMOD:255 | name | Delta:H(4)C(2) | def | "Acetaldehyde +28." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=255] | comment | Reduction of Schiff base formed between K amino group and acetaldehyde. | xref | record_id "255" | xref | delta_mono_mass "28.0313" | xref | delta_avge_mass "28.0532" | xref | delta_composition "H(4) C(2)" | xref | username_of_poster "fatcat" | xref | group_of_poster "users" | xref | date_time_posted "2004-08-12 20:02:38" | xref | date_time_modified "2011-11-21 13:14:58" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:256] === UNIMOD:256 Delta:H(4)C(3) |
null .Term [UNIMOD:256] [cols="2*"] |
| id | UNIMOD:256 | name | Delta:H(4)C(3) | def | "Propionaldehyde +40." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=256] | xref | record_id "256" | xref | delta_mono_mass "40.0313" | xref | delta_avge_mass "40.0639" | xref | delta_composition "H(4) C(3)" | xref | username_of_poster "fatcat" | xref | group_of_poster "users" | xref | date_time_posted "2004-08-12 20:04:01" | xref | date_time_modified "2010-02-25 10:49:55" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:258] === UNIMOD:258 Label:18O(1) |
null .Term [UNIMOD:258] [cols="2*"] |
| id | UNIMOD:258 | name | Label:18O(1) | def | "O18 Labeling." [PMID:11467524, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=258] | synonym | "H2 18O Alkaline Phosphatase" [] | xref | record_id "258" | xref | delta_mono_mass "2.004246" | xref | delta_avge_mass "1.9998" | xref | delta_composition "O(-1) 18O" | xref | username_of_poster "chemgirl18" | xref | group_of_poster "users" | xref | date_time_posted "2004-08-27 21:57:17" | xref | date_time_modified "2006-10-13 18:53:41" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "alkaline phosphatase to dephosphorylate" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_2_misc_notes "alkaline phosphatase to dephosphorylate" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "alkaline phosphatase to dephosphorylate" | xref | spec_4_group "4" | xref | spec_4_hidden "0" | xref | spec_4_site "C-term" | xref | spec_4_position "Any C-term" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "digesting in labelled water" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:259] === UNIMOD:259 Label:13C(6)15N(2) |
null .Term [UNIMOD:259] [cols="2*"] |
| id | UNIMOD:259 | name | Label:13C(6)15N(2) | def | "13C(6) 15N(2) Silac label." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=259] | synonym | "heavy lysine" [] | xref | record_id "259" | xref | delta_mono_mass "8.014199" | xref | delta_avge_mass "7.9427" | xref | delta_composition "C(-6) 13C(6) N(-2) 15N(2)" | xref | username_of_poster "hs01" | xref | group_of_poster "users" | xref | date_time_posted "2004-08-30 16:23:02" | xref | date_time_modified "2014-06-09 09:40:49" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in SILAC experiment" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:260] === UNIMOD:260 Thiophospho |
null .Term [UNIMOD:260] [cols="2*"] |
| id | UNIMOD:260 | name | Thiophospho | def | "Thiophosphorylation." [PMID:12110917, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=260] | xref | record_id "260" | xref | delta_mono_mass "95.943487" | xref | delta_avge_mass "96.0455" | xref | delta_composition "H O(2) P S" | xref | username_of_poster "mrbladergroen" | xref | group_of_poster "users" | xref | date_time_posted "2004-09-01 13:20:58" | xref | date_time_modified "2006-10-16 12:38:48" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:261] === UNIMOD:261 SPITC |
null .Term [UNIMOD:261] [cols="2*"] |
| id | UNIMOD:261 | name | SPITC | def | "4-sulfophenyl isothiocyanate." [URL:http\://www.shimadzu-biotech.net/literature/application_note/202_1.pdf, PMID:14745769, PMID:14689565, PMID:16526082, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=261] | synonym | "N-terminal / lysine sulfonation" [] | xref | record_id "261" | xref | delta_mono_mass "214.971084" | xref | delta_avge_mass "215.2495" | xref | delta_composition "H(5) C(7) N O(3) S(2)" | xref | username_of_poster "hatlevig" | xref | group_of_poster "users" | xref | date_time_posted "2004-09-14 20:01:29" | xref | date_time_modified "2006-10-16 15:26:00" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:262] === UNIMOD:262 Label:2H(3) |
null .Term [UNIMOD:262] [cols="2*"] |
| id | UNIMOD:262 | name | Label:2H(3) | def | "Trideuteration." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=262] | synonym | "Trideuteration" [] | xref | record_id "262" | xref | delta_mono_mass "3.01883" | xref | delta_avge_mass "3.0185" | xref | delta_composition "H(-3) 2H(3)" | xref | username_of_poster "mmolloy" | xref | group_of_poster "users" | xref | date_time_posted "2004-09-29 08:52:01" | xref | date_time_modified "2013-02-22 12:42:11" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "for SILAC expt" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "M" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:264] === UNIMOD:264 PET |
null .Term [UNIMOD:264] [cols="2*"] |
| id | UNIMOD:264 | name | PET | def | "Phosphorylation to pyridyl thiol." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=264] | comment | PET = 2-[4-pyridyl]ethanethiol. This modification is a chemical derivative, based on a alkaline catalysed beta-elimination of phosphoserines and phosphothreonines and subsequent 1,4-addition of 2-[4-pyridine]ethanethiol. These modified serines and threonines produce in MS/MS a characteristic fragment which can be used for precursor-ion-scan experiments. | synonym | "b-elimination PET derivatisation" [] | xref | record_id "264" | xref | delta_mono_mass "121.035005" | xref | delta_avge_mass "121.2028" | xref | delta_composition "H(7) C(7) N O(-1) S" | xref | username_of_poster "vbad" | xref | group_of_poster "users" | xref | date_time_posted "2004-10-07 08:55:33" | xref | date_time_modified "2006-10-16 12:48:51" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:267] === UNIMOD:267 Label:13C(6)15N(4) |
null .Term [UNIMOD:267] [cols="2*"] |
| id | UNIMOD:267 | name | Label:13C(6)15N(4) | def | "13C(6) 15N(4) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=267] | xref | record_id "267" | xref | delta_mono_mass "10.008269" | xref | delta_avge_mass "9.9296" | xref | delta_composition "C(-6) 13C(6) N(-4) 15N(4)" | xref | username_of_poster "AFCS" | xref | group_of_poster "users" | xref | date_time_posted "2004-10-20 17:49:33" | xref | date_time_modified "2006-10-19 10:30:51" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in SILAC experiment" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:268] === UNIMOD:268 Label:13C(5)15N(1) |
null .Term [UNIMOD:268] [cols="2*"] |
| id | UNIMOD:268 | name | Label:13C(5)15N(1) | def | "13C(5) 15N(1) Silac label." [PMID:12771378, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=268] | xref | record_id "268" | xref | delta_mono_mass "6.013809" | xref | delta_avge_mass "5.9567" | xref | delta_composition "C(-5) 13C(5) N(-1) 15N" | xref | username_of_poster "Deepa" | xref | group_of_poster "users" | xref | date_time_posted "2004-11-05 18:49:37" | xref | date_time_modified "2011-11-21 14:48:39" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in AQUA experiment" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "P" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_2_misc_notes "Result of conversion of 13C6, 15N4 arginine to 13C5, 15N1 proline" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "M" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "SILAC label used in COFRADIC" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "E" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:269] === UNIMOD:269 Label:13C(9)15N(1) |
null .Term [UNIMOD:269] [cols="2*"] |
| id | UNIMOD:269 | name | Label:13C(9)15N(1) | def | "13C(9) 15N(1) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12771378, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=269] | xref | record_id "269" | xref | delta_mono_mass "10.027228" | xref | delta_avge_mass "9.9273" | xref | delta_composition "C(-9) 13C(9) N(-1) 15N" | xref | username_of_poster "Deepa" | xref | group_of_poster "users" | xref | date_time_posted "2004-11-05 18:51:13" | xref | date_time_modified "2006-10-19 10:31:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in AQUA experiment" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:270] === UNIMOD:270 Cytopiloyne |
null .Term [UNIMOD:270] [cols="2*"] |
| id | UNIMOD:270 | name | Cytopiloyne | def | "Nucleophilic addtion to cytopiloyne." [PMID:15549660, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=270] | comment | Cytopiloyne is a polyacetylenic glucoside isolated form Bidens pilosa which can modulate T helper cell differentiation. Biotinylated cytopiloyne might be use to identify its receptor in T cell. | xref | record_id "270" | xref | delta_mono_mass "362.136553" | xref | delta_avge_mass "362.3738" | xref | delta_composition "H(22) C(19) O(7)" | xref | username_of_poster "ymchiang" | xref | group_of_poster "users" | xref | date_time_posted "2004-11-10 03:13:23" | xref | date_time_modified "2006-10-16 16:35:54" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "P" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "R" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "S" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "Y" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:271] === UNIMOD:271 Cytopiloyne+water |
null .Term [UNIMOD:271] [cols="2*"] |
| id | UNIMOD:271 | name | Cytopiloyne+water | def | "Nucleophilic addition to cytopiloyne+H2O." [PMID:15549660, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=271] | comment | Cytopiloyne is a polyacetylenic glucoside isolated form Bidens pilosa which can modulated T helper cell differentiation. Biotinylated cytopiloyne might be use to identify its receptor in T cell. | xref | record_id "271" | xref | delta_mono_mass "380.147118" | xref | delta_avge_mass "380.3891" | xref | delta_composition "H(24) C(19) O(8)" | xref | username_of_poster "ymchiang" | xref | group_of_poster "users" | xref | date_time_posted "2004-11-11 05:23:17" | xref | date_time_modified "2006-10-16 16:37:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "R" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "Y" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:272] === UNIMOD:272 CAF |
null .Term [UNIMOD:272] [cols="2*"] |
| id | UNIMOD:272 | name | CAF | def | "Sulfonation of N-terminus." [PMID:15732931, PMID:16046801, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=272] | comment | N-terminal sulfonation of diglycine to detect ubiquitination sites. | synonym | "Ettan CAF MALDI" [] | xref | record_id "272" | xref | delta_mono_mass "135.983029" | xref | delta_avge_mass "136.1265" | xref | delta_composition "H(4) C(3) O(4) S" | xref | username_of_poster "chens002" | xref | group_of_poster "users" | xref | date_time_posted "2004-11-16 14:25:33" | xref | date_time_modified "2007-01-03 19:34:35" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:275] === UNIMOD:275 Nitrosyl |
null .Term [UNIMOD:275] [cols="2*"] |
| id | UNIMOD:275 | name | Nitrosyl | def | "Nitrosylation." [FindMod:NTRY, PMID:10442087, RESID:AA0230, PMID:15688001, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=275] | xref | record_id "275" | xref | delta_mono_mass "28.990164" | xref | delta_avge_mass "28.9982" | xref | delta_composition "H(-1) N O" | xref | username_of_poster "dengh" | xref | group_of_poster "users" | xref | date_time_posted "2004-12-11 00:23:12" | xref | date_time_modified "2019-09-10 09:17:23" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_misc_notes "S-nitrosylation" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Y" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "photochemical decomposition" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:276] === UNIMOD:276 AEBS |
null .Term [UNIMOD:276] [cols="2*"] |
| id | UNIMOD:276 | name | AEBS | def | "Aminoethylbenzenesulfonylation." [PMID:8597590, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=276] | comment | Potential protein modification when using AEBSF (Pefabloc) as a serine protease inhibitor. | xref | record_id "276" | xref | delta_mono_mass "183.035399" | xref | delta_avge_mass "183.2276" | xref | delta_composition "H(9) C(8) N O(2) S" | xref | username_of_poster "plattm" | xref | group_of_poster "users" | xref | date_time_posted "2004-12-14 04:38:25" | xref | date_time_modified "2006-10-16 15:04:42" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Artefact" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Artefact" | xref | spec_4_misc_notes "Primary site of modification" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "Y" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:278] === UNIMOD:278 Ethanolyl |
null .Term [UNIMOD:278] [cols="2*"] |
| id | UNIMOD:278 | name | Ethanolyl | def | "Ethanolation." [PMID:15351294, PMID:7730303, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=278] | synonym | "Hydroxy ethyl" [] | xref | record_id "278" | xref | delta_mono_mass "44.026215" | xref | delta_avge_mass "44.0526" | xref | delta_composition "H(4) C(2) O" | xref | username_of_poster "knierman" | xref | group_of_poster "users" | xref | date_time_posted "2005-01-11 04:26:47" | xref | date_time_modified "2017-10-09 15:47:39" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "from reaction of SH group with iodoethanol" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "reduced form of oxidation product" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "R" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_3_misc_notes "reduced form of oxidation product" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:280] === UNIMOD:280 Ethyl |
null .Term [UNIMOD:280] [cols="2*"] |
| id | UNIMOD:280 | name | Ethyl | def | "Ethylation." [PMID:9629898, URL:http\://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=2911956&tool=pmcentrez&rendertype=abstract, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=280] | xref | record_id "280" | xref | delta_mono_mass "28.0313" | xref | delta_avge_mass "28.0532" | xref | delta_composition "H(4) C(2)" | xref | username_of_poster "Qishanl" | xref | group_of_poster "users" | xref | date_time_posted "2005-01-27 23:18:07" | xref | date_time_modified "2015-08-26 14:42:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Multiple" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "E" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Artefact" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N-term" | xref | spec_4_position "Protein N-term" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "C-term" | xref | spec_5_position "Any C-term" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "D" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:281] === UNIMOD:281 CoenzymeA |
null .Term [UNIMOD:281] [cols="2*"] |
| id | UNIMOD:281 | name | CoenzymeA | def | "Cysteine modified Coenzyme A." [URL:http\://commons.wikimedia.org/wiki/Image\:Coenzyme_a.png, RESID:AA0306, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=281] | xref | record_id "281" | xref | delta_mono_mass "765.09956" | xref | delta_avge_mass "765.5182" | xref | delta_composition "H(34) C(21) N(7) O(16) P(3) S" | xref | username_of_poster "tremis" | xref | group_of_poster "users" | xref | date_time_posted "2005-02-01 17:10:00" | xref | date_time_modified "2006-10-16 17:15:18" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:284] === UNIMOD:284 Methyl:2H(2) |
null .Term [UNIMOD:284] [cols="2*"] |
| id | UNIMOD:284 | name | Methyl:2H(2) | def | "Deuterium Methylation of Lysine." [PMID:15525938, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=284] | xref | record_id "284" | xref | delta_mono_mass "16.028204" | xref | delta_avge_mass "16.0389" | xref | delta_composition "2H(2) C" | xref | username_of_poster "Glebivanov" | xref | group_of_poster "users" | xref | date_time_posted "2005-02-13 01:26:38" | xref | date_time_modified "2016-06-14 11:53:24" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:285] === UNIMOD:285 SulfanilicAcid |
null .Term [UNIMOD:285] [cols="2*"] |
| id | UNIMOD:285 | name | SulfanilicAcid | def | "Light Sulfanilic Acid (SA) C12." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=285] | synonym | "C-Terminal/Glutamate/Aspartate sulfonation" [] | xref | record_id "285" | xref | delta_mono_mass "155.004099" | xref | delta_avge_mass "155.1744" | xref | delta_composition "H(5) C(6) N O(2) S" | xref | username_of_poster "apanchaud" | xref | group_of_poster "users" | xref | date_time_posted "2005-02-17 15:48:07" | xref | date_time_modified "2006-10-16 14:05:34" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "E" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:286] === UNIMOD:286 SulfanilicAcid:13C(6) |
null .Term [UNIMOD:286] [cols="2*"] |
| id | UNIMOD:286 | name | SulfanilicAcid:13C(6) | def | "Heavy Sulfanilic Acid (SA) C13." [PMID:9254591, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=286] | synonym | "C-Terminal/Glutamate/Aspartate sulfonation" [] | xref | record_id "286" | xref | delta_mono_mass "161.024228" | xref | delta_avge_mass "161.1303" | xref | delta_composition "H(5) 13C(6) N O(2) S" | xref | username_of_poster "apanchaud" | xref | group_of_poster "users" | xref | date_time_posted "2005-02-17 15:55:52" | xref | date_time_modified "2006-10-16 14:08:42" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "E" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:288] === UNIMOD:288 Trp→Oxolactone |
null .Term [UNIMOD:288] [cols="2*"] |
| id | UNIMOD:288 | name | Trp→Oxolactone | def | "Tryptophan oxidation to oxolactone." [PMID:7949339, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=288] | comment | The cleavage of a peptide bond between Try-Xxx with oxidation of tryptophan to the oxolactone occurs in the presence of BNPS-skatole. This is a useful method for the chemical cleavage of proteins specifically at tryptophan residues. | xref | record_id "288" | xref | delta_mono_mass "13.979265" | xref | delta_avge_mass "13.9835" | xref | delta_composition "H(-2) O" | xref | username_of_poster "oxolactone" | xref | group_of_poster "users" | xref | date_time_posted "2005-02-25 23:30:20" | xref | date_time_modified "2006-10-14 10:06:01" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:289] === UNIMOD:289 Biotin-PEO-Amine |
null .Term [UNIMOD:289] [cols="2*"] |
| id | UNIMOD:289 | name | Biotin-PEO-Amine | def | "Biotin polyethyleneoxide amine." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=289] | comment | EDC crosslinker is used to couple biotin PEO-amine to carboxyl groups or 5\' phosphate groups. | xref | record_id "289" | xref | delta_mono_mass "356.188212" | xref | delta_avge_mass "356.4835" | xref | delta_composition "H(28) C(16) N(4) O(3) S" | xref | username_of_poster "TBricker1" | xref | group_of_poster "users" | xref | date_time_posted "2005-03-02 16:49:17" | xref | date_time_modified "2006-11-14 11:15:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "EDC-coupled modification of D, E and C-terminus" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "EDC-coupled modification of D, E and C-terminus" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "E" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_3_misc_notes "EDC-coupled modification of D, E and C-terminus" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:290] === UNIMOD:290 Biotin-HPDP |
null .Term [UNIMOD:290] [cols="2*"] |
| id | UNIMOD:290 | name | Biotin-HPDP | def | "Pierce EZ-Link Biotin-HPDP." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031002, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=290] | xref | record_id "290" | xref | delta_mono_mass "428.191582" | xref | delta_avge_mass "428.6124" | xref | delta_composition "H(32) C(19) N(4) O(3) S(2)" | xref | username_of_poster "tgreco" | xref | group_of_poster "users" | xref | date_time_posted "2005-03-03 22:56:52" | xref | date_time_modified "2010-12-03 16:28:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:291] === UNIMOD:291 Delta:Hg(1) |
null .Term [UNIMOD:291] [cols="2*"] |
| id | UNIMOD:291 | name | Delta:Hg(1) | def | "Mercury Mercaptan." [PMID:10695144, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=291] | xref | record_id "291" | xref | delta_mono_mass "201.970617" | xref | delta_avge_mass "200.59" | xref | delta_composition "Hg" | xref | username_of_poster "tgreco" | xref | group_of_poster "users" | xref | date_time_posted "2005-03-03 23:53:00" | xref | date_time_modified "2006-10-16 15:09:18" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:292] === UNIMOD:292 IodoU-AMP |
null .Term [UNIMOD:292] [cols="2*"] |
| id | UNIMOD:292 | name | IodoU-AMP | def | "(Iodo)-uracil MP." [PMID:11567090, PMID:11112526, PMID:6540775, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=292] | comment | One note about this chemistry is that for W you have to take care of O2 big time (and extract the I-uracil monophosphate with organics to get rid of residual iodide). | synonym | "UV induced linkage of Iodo-U-amp with WFY" [] | xref | record_id "292" | xref | delta_mono_mass "322.020217" | xref | delta_avge_mass "322.1654" | xref | delta_composition "H(11) C(9) N(2) O(9) P" | xref | username_of_poster "davidERICanderson" | xref | group_of_poster "users" | xref | date_time_posted "2005-03-04 22:57:55" | xref | date_time_modified "2017-01-31 13:36:23" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "Used in base/residue interactions (in principle?)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "W" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "Used in base/residue interactions (observed)" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_3_misc_notes "Used in base/residue interactions (in principle?)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:293] === UNIMOD:293 CAMthiopropanoyl |
null .Term [UNIMOD:293] [cols="2*"] |
| id | UNIMOD:293 | name | CAMthiopropanoyl | def | "3-(carbamidomethylthio)propanoyl." [PMID:15121203, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=293] | synonym | "3-thiopropanoyl moiety from reduced DSP crosslinker or NHS-SS-biotin, modified with Iodoacetamide" [] | xref | record_id "293" | xref | delta_mono_mass "145.019749" | xref | delta_avge_mass "145.1796" | xref | delta_composition "H(7) C(5) N O(2) S" | xref | username_of_poster "vanschra" | xref | group_of_poster "users" | xref | date_time_posted "2005-03-09 15:22:46" | xref | date_time_modified "2006-10-16 13:58:55" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:294] === UNIMOD:294 IED-Biotin |
null .Term [UNIMOD:294] [cols="2*"] |
| id | UNIMOD:294 | name | IED-Biotin | def | "Biotinoyl-iodoacetyl-ethylenediamine." [PMID:10906242, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=294] | xref | record_id "294" | xref | delta_mono_mass "326.141261" | xref | delta_avge_mass "326.4145" | xref | delta_composition "H(22) C(14) N(4) O(3) S" | xref | username_of_poster "alexey" | xref | group_of_poster "users" | xref | date_time_posted "2005-03-10 16:28:09" | xref | date_time_modified "2006-10-16 15:53:29" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:295] === UNIMOD:295 dHex |
null .Term [UNIMOD:295] [cols="2*"] |
| id | UNIMOD:295 | name | dHex | def | "Fucose." [PMID:15189151, PMID:11344537, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=295] | synonym | "deoxyhexose" [] | xref | record_id "295" | xref | delta_mono_mass "146.057909" | xref | delta_avge_mass "146.1412" | xref | delta_composition "dHex" | xref | username_of_poster "rsack" | xref | group_of_poster "users" | xref | date_time_posted "2005-03-22 16:57:00" | xref | date_time_modified "2017-11-23 11:42:26" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_147_mono_mass "146.057909" | xref | spec_1_neutral_loss_147_avge_mass "146.1412" | xref | spec_1_neutral_loss_147_flag "false" | xref | spec_1_neutral_loss_147_composition "dHex" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_147_mono_mass "146.057909" | xref | spec_1_neutral_loss_147_avge_mass "146.1412" | xref | spec_1_neutral_loss_147_flag "false" | xref | spec_1_neutral_loss_147_composition "dHex" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_misc_notes "Not reported for human proteins" | xref | spec_2_neutral_loss_147_mono_mass "146.057909" | xref | spec_2_neutral_loss_147_avge_mass "146.1412" | xref | spec_2_neutral_loss_147_flag "false" | xref | spec_2_neutral_loss_147_composition "dHex" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:298] === UNIMOD:298 Methyl:2H(3) |
null .Term [UNIMOD:298] [cols="2*"] |
| id | UNIMOD:298 | name | Methyl:2H(3) | def | "Deuterated methyl ester." [URL:http\://www.sigmaaldrich.com/technical-documents/articles/stable-isotopes/stable-isotope-labeling-by-amino-acids.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=298] | xref | record_id "298" | xref | delta_mono_mass "17.03448" | xref | delta_avge_mass "17.0451" | xref | delta_composition "H(-1) 2H(3) C" | xref | username_of_poster "ndacoyas" | xref | group_of_poster "users" | xref | date_time_posted "2005-03-24 16:31:28" | xref | date_time_modified "2013-02-07 16:43:18" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "esterification of carboxylic acids using D3-Methanolic HCl" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_2_misc_notes "esterification of carboxylic acids using D3-Methanolic HCl" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "E" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "esterification of carboxylic acids using D3-Methanolic HCl" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "K" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "SILAC labelling with L-Methionine-(methyl-d3)" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "R" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_5_misc_notes "SILAC labelling with L-Methionine-(methyl-d3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:299] === UNIMOD:299 Carboxy |
null .Term [UNIMOD:299] [cols="2*"] |
| id | UNIMOD:299 | name | Carboxy | def | "Carboxylation." [RESID:AA0114, FindMod:GGLU, RESID:AA0363, RESID:AA0032, PMID:3802193, RESID:AA0304, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=299] | xref | record_id "299" | xref | delta_mono_mass "43.989829" | xref | delta_avge_mass "44.0095" | xref | delta_composition "C O(2)" | xref | username_of_poster "Carol" | xref | group_of_poster "users" | xref | date_time_posted "2005-03-29 22:55:44" | xref | date_time_modified "2006-11-14 11:08:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "D" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_3_misc_notes "Gamma-carboxylation" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "E" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_4_misc_notes "Gamma-carboxylation" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "M" | xref | spec_5_position "Protein N-term" | xref | spec_5_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:301] === UNIMOD:301 Bromobimane |
null .Term [UNIMOD:301] [cols="2*"] |
| id | UNIMOD:301 | name | Bromobimane | def | "Monobromobimane derivative." [PMID:7856876, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=301] | synonym | "mBromobimane" [] | xref | record_id "301" | xref | delta_mono_mass "190.074228" | xref | delta_avge_mass "190.1986" | xref | delta_composition "H(10) C(10) N(2) O(2)" | xref | username_of_poster "catsriku" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-04 23:03:13" | xref | date_time_modified "2006-10-16 15:07:49" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:302] === UNIMOD:302 Menadione |
null .Term [UNIMOD:302] [cols="2*"] |
| id | UNIMOD:302 | name | Menadione | def | "Menadione quinone derivative." [PMID:15939799, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=302] | synonym | "Vitamin k3 (Q)" [] | xref | record_id "302" | xref | delta_mono_mass "170.036779" | xref | delta_avge_mass "170.1641" | xref | delta_composition "H(6) C(11) O(2)" | xref | username_of_poster "catsriku" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-04 23:21:29" | xref | date_time_modified "2007-07-12 07:36:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:303] === UNIMOD:303 DeStreak |
null .Term [UNIMOD:303] [cols="2*"] |
| id | UNIMOD:303 | name | DeStreak | def | "Cysteine mercaptoethanol." [PMID:12442261, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=303] | xref | record_id "303" | xref | delta_mono_mass "75.998285" | xref | delta_avge_mass "76.1176" | xref | delta_composition "H(4) C(2) O S" | xref | username_of_poster "harald" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-11 14:06:08" | xref | date_time_modified "2006-10-16 11:07:55" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:305] === UNIMOD:305 dHex(1)Hex(3)HexNAc(4) |
null .Term [UNIMOD:305] [cols="2*"] |
| id | UNIMOD:305 | name | dHex(1)Hex(3)HexNAc(4) | def | "Fucosylated biantennary (-2 galactose)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=305] | xref | record_id "305" | xref | delta_mono_mass "1444.53387" | xref | delta_avge_mass "1445.3331" | xref | delta_composition "dHex Hex(3) HexNAc(4)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-25 18:20:12" | xref | date_time_modified "2017-06-02 14:24:06" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1445_mono_mass "1444.53387" | xref | spec_1_neutral_loss_1445_avge_mass "1445.3331" | xref | spec_1_neutral_loss_1445_flag "false" | xref | spec_1_neutral_loss_1445_composition "dHex Hex(3) HexNAc(4)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_1445_mono_mass "1444.53387" | xref | spec_2_neutral_loss_1445_avge_mass "1445.3331" | xref | spec_2_neutral_loss_1445_flag "false" | xref | spec_2_neutral_loss_1445_composition "dHex Hex(3) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1445_mono_mass "1444.53387" | xref | spec_2_neutral_loss_1445_avge_mass "1445.3331" | xref | spec_2_neutral_loss_1445_flag "false" | xref | spec_2_neutral_loss_1445_composition "dHex Hex(3) HexNAc(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:307] === UNIMOD:307 dHex(1)Hex(4)HexNAc(4) |
null .Term [UNIMOD:307] [cols="2*"] |
| id | UNIMOD:307 | name | dHex(1)Hex(4)HexNAc(4) | def | "DHex Hex(4) HexNAc(4) ---OR--- Hex(4) HexNAc(4) Pent Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=307] | synonym | "Fucosylated biantennary (-1 galactose)" [] | xref | record_id "307" | xref | delta_mono_mass "1606.586693" | xref | delta_avge_mass "1607.4737" | xref | delta_composition "dHex Hex(4) HexNAc(4)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-25 19:22:11" | xref | date_time_modified "2017-11-22 10:34:55" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1607_mono_mass "1606.586693" | xref | spec_1_neutral_loss_1607_avge_mass "1607.4737" | xref | spec_1_neutral_loss_1607_flag "false" | xref | spec_1_neutral_loss_1607_composition "dHex Hex(4) HexNAc(4)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_1607_mono_mass "1606.586693" | xref | spec_2_neutral_loss_1607_avge_mass "1607.4737" | xref | spec_2_neutral_loss_1607_flag "false" | xref | spec_2_neutral_loss_1607_composition "dHex Hex(4) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1607_mono_mass "1606.586693" | xref | spec_2_neutral_loss_1607_avge_mass "1607.4737" | xref | spec_2_neutral_loss_1607_flag "false" | xref | spec_2_neutral_loss_1607_composition "dHex Hex(4) HexNAc(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:308] === UNIMOD:308 dHex(1)Hex(5)HexNAc(4) |
null .Term [UNIMOD:308] [cols="2*"] |
| id | UNIMOD:308 | name | dHex(1)Hex(5)HexNAc(4) | def | "Fucosylated biantennary." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=308] | xref | record_id "308" | xref | delta_mono_mass "1768.639517" | xref | delta_avge_mass "1769.6143" | xref | delta_composition "dHex Hex(5) HexNAc(4)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-25 19:25:17" | xref | date_time_modified "2017-06-02 14:24:27" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1769_mono_mass "1768.639517" | xref | spec_1_neutral_loss_1769_avge_mass "1769.6143" | xref | spec_1_neutral_loss_1769_flag "false" | xref | spec_1_neutral_loss_1769_composition "dHex Hex(5) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:309] === UNIMOD:309 Hex(3)HexNAc(4) |
null .Term [UNIMOD:309] [cols="2*"] |
| id | UNIMOD:309 | name | Hex(3)HexNAc(4) | def | "Biantennary (-2 galactose)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=309] | xref | record_id "309" | xref | delta_mono_mass "1298.475961" | xref | delta_avge_mass "1299.1919" | xref | delta_composition "Hex(3) HexNAc(4)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-25 19:27:51" | xref | date_time_modified "2017-06-02 14:24:37" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1299_mono_mass "1298.475961" | xref | spec_1_neutral_loss_1299_avge_mass "1299.1919" | xref | spec_1_neutral_loss_1299_flag "false" | xref | spec_1_neutral_loss_1299_composition "Hex(3) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_1299_mono_mass "1298.475961" | xref | spec_2_neutral_loss_1299_avge_mass "1299.1919" | xref | spec_2_neutral_loss_1299_flag "false" | xref | spec_2_neutral_loss_1299_composition "Hex(3) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1299_mono_mass "1298.475961" | xref | spec_2_neutral_loss_1299_avge_mass "1299.1919" | xref | spec_2_neutral_loss_1299_flag "false" | xref | spec_2_neutral_loss_1299_composition "Hex(3) HexNAc(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:310] === UNIMOD:310 Hex(4)HexNAc(4) |
null .Term [UNIMOD:310] [cols="2*"] |
| id | UNIMOD:310 | name | Hex(4)HexNAc(4) | def | "Biantennary (-1 galactose)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=310] | xref | record_id "310" | xref | delta_mono_mass "1460.528784" | xref | delta_avge_mass "1461.3325" | xref | delta_composition "Hex(4) HexNAc(4)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-25 19:33:37" | xref | date_time_modified "2017-06-02 14:24:51" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1461_mono_mass "1460.528784" | xref | spec_1_neutral_loss_1461_avge_mass "1461.3325" | xref | spec_1_neutral_loss_1461_flag "false" | xref | spec_1_neutral_loss_1461_composition "Hex(4) HexNAc(4)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_1461_mono_mass "1460.528784" | xref | spec_2_neutral_loss_1461_avge_mass "1461.3325" | xref | spec_2_neutral_loss_1461_flag "false" | xref | spec_2_neutral_loss_1461_composition "Hex(4) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_1461_mono_mass "1460.528784" | xref | spec_2_neutral_loss_1461_avge_mass "1461.3325" | xref | spec_2_neutral_loss_1461_flag "false" | xref | spec_2_neutral_loss_1461_composition "Hex(4) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:311] === UNIMOD:311 Hex(5)HexNAc(4) |
null .Term [UNIMOD:311] [cols="2*"] |
| id | UNIMOD:311 | name | Hex(5)HexNAc(4) | def | "Biantennary." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=311] | xref | record_id "311" | xref | delta_mono_mass "1622.581608" | xref | delta_avge_mass "1623.4731" | xref | delta_composition "Hex(5) HexNAc(4)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-25 19:35:54" | xref | date_time_modified "2017-11-24 13:06:38" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1623_mono_mass "1622.581608" | xref | spec_1_neutral_loss_1623_avge_mass "1623.4731" | xref | spec_1_neutral_loss_1623_flag "false" | xref | spec_1_neutral_loss_1623_composition "Hex(5) HexNAc(4)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_misc_notes "Not reported for human proteins" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1623_mono_mass "1622.581608" | xref | spec_2_neutral_loss_1623_avge_mass "1623.4731" | xref | spec_2_neutral_loss_1623_flag "false" | xref | spec_2_neutral_loss_1623_composition "Hex(5) HexNAc(4)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_misc_notes "Not reported for human proteins" | xref | spec_2_neutral_loss_1623_mono_mass "1622.581608" | xref | spec_2_neutral_loss_1623_avge_mass "1623.4731" | xref | spec_2_neutral_loss_1623_flag "false" | xref | spec_2_neutral_loss_1623_composition "Hex(5) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:312] === UNIMOD:312 Cysteinyl |
null .Term [UNIMOD:312] [cols="2*"] |
| id | UNIMOD:312 | name | Cysteinyl | def | "Cysteinylation." [RESID:AA0025, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=312] | xref | record_id "312" | xref | delta_mono_mass "119.004099" | xref | delta_avge_mass "119.1423" | xref | delta_composition "H(5) C(3) N O(2) S" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-25 19:59:43" | xref | date_time_modified "2006-12-17 11:28:36" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:313] === UNIMOD:313 Lys-loss |
null .Term [UNIMOD:313] [cols="2*"] |
| id | UNIMOD:313 | name | Lys-loss | def | "Loss of C-terminal K from Heavy Chain of MAb." [PMID:16078144, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=313] | xref | record_id "313" | xref | delta_mono_mass "-128.094963" | xref | delta_avge_mass "-128.1723" | xref | delta_composition "H(-12) C(-6) N(-2) O(-1)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-25 20:05:38" | xref | date_time_modified "2006-10-13 15:00:47" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:314] === UNIMOD:314 Nmethylmaleimide |
null .Term [UNIMOD:314] [cols="2*"] |
| id | UNIMOD:314 | name | Nmethylmaleimide | def | "Nmethylmaleimide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=314] | xref | record_id "314" | xref | delta_mono_mass "111.032028" | xref | delta_avge_mass "111.0987" | xref | delta_composition "H(5) C(5) N O(2)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-04-25 20:12:24" | xref | date_time_modified "2006-10-16 17:26:09" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:316] === UNIMOD:316 DimethylpyrroleAdduct |
null .Term [UNIMOD:316] [cols="2*"] |
| id | UNIMOD:316 | name | DimethylpyrroleAdduct | def | "2,5-dimethypyrrole." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=316] | xref | record_id "316" | xref | delta_mono_mass "78.04695" | xref | delta_avge_mass "78.1118" | xref | delta_composition "H(6) C(6)" | xref | username_of_poster "Qishanl" | xref | group_of_poster "users" | xref | date_time_posted "2005-05-07 03:11:23" | xref | date_time_modified "2006-10-16 11:14:22" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:318] === UNIMOD:318 Delta:H(2)C(5) |
null .Term [UNIMOD:318] [cols="2*"] |
| id | UNIMOD:318 | name | Delta:H(2)C(5) | def | "MDA adduct +62." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=318] | comment | Usually major adduct formed from malondialdehyde (MDA) with the amino group of lysine residues. | synonym | "MDA62" [] | xref | record_id "318" | xref | delta_mono_mass "62.01565" | xref | delta_avge_mass "62.0694" | xref | delta_composition "H(2) C(5)" | xref | username_of_poster "rkupfer" | xref | group_of_poster "users" | xref | date_time_posted "2005-05-12 22:00:21" | xref | date_time_modified "2006-10-16 10:29:55" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:319] === UNIMOD:319 Delta:H(2)C(3)O(1) |
null .Term [UNIMOD:319] [cols="2*"] |
| id | UNIMOD:319 | name | Delta:H(2)C(3)O(1) | def | "MDA adduct +54." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=319] | synonym | "MDA54" [] | xref | record_id "319" | xref | delta_mono_mass "54.010565" | xref | delta_avge_mass "54.0474" | xref | delta_composition "H(2) C(3) O" | xref | username_of_poster "rkupfer" | xref | group_of_poster "users" | xref | date_time_posted "2005-05-12 22:12:10" | xref | date_time_modified "2006-10-16 10:15:34" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "Malondialdehyde (MDA) adduct" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "5-hydro-5-methylimidazol-4-one, Methylglyoxal adduct" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:320] === UNIMOD:320 Nethylmaleimide+water |
null .Term [UNIMOD:320] [cols="2*"] |
| id | UNIMOD:320 | name | Nethylmaleimide+water | def | "Nethylmaleimidehydrolysis." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=320] | xref | record_id "320" | xref | delta_mono_mass "143.058243" | xref | delta_avge_mass "143.1406" | xref | delta_composition "H(9) C(6) N O(3)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2005-05-16 22:18:42" | xref | date_time_modified "2006-10-17 11:40:14" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:323] === UNIMOD:323 Xlink:B10621 |
null .Term [UNIMOD:323] [cols="2*"] |
| id | UNIMOD:323 | name | Xlink:B10621 | def | "Bis-((N-iodoacetyl)piperazinyl)sulfonerhodamine." [URL:https\://www.thermofisher.com/us/en/home/references/molecular-probes-the-handbook/crosslinking-and-photoactivatable-reagents/chemical-crosslinking-reagents.html#head2, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=323] | comment | Discontinued Invitrogen X-link reagent. | synonym | "BSR monolink" [] | xref | record_id "323" | xref | delta_mono_mass "713.093079" | xref | delta_avge_mass "713.5626" | xref | delta_composition "H(30) C(31) N(4) O(6) S I" | xref | username_of_poster "dengh" | xref | group_of_poster "users" | xref | date_time_posted "2005-05-17 22:56:12" | xref | date_time_modified "2017-09-05 15:32:46" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:324] === UNIMOD:324 X87 |
null .Term [UNIMOD:324] [cols="2*"] |
| id | UNIMOD:324 | name | X87 | def | "Cleaved and reduced DTBP crosslinker." [PMID:770170, URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011314_ImidoesterCrsLnk_DMA_DMP_DMS_DTBP_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=324] | comment | Imidoester cross-linker. | synonym | "dimethyl 3,3'-dithiobispropionimidate" [] | xref | record_id "324" | xref | delta_mono_mass "87.01427" | xref | delta_avge_mass "87.1435" | xref | delta_composition "H(5) C(3) N S" | xref | username_of_poster "takesin" | xref | group_of_poster "users" | xref | date_time_posted "2005-05-18 08:43:26" | xref | date_time_modified "2017-08-18 14:19:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:325] === UNIMOD:325 FP-Biotin |
null .Term [UNIMOD:325] [cols="2*"] |
| id | UNIMOD:325 | name | FP-Biotin | def | "10-ethoxyphosphinyl-N-(biotinamidopentyl)decanamide." [PMID:10611275, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=325] | comment | FP-biotin was designed to label the active site serine of serine esterases/proteases. | synonym | "O-ethyl-N-(biotinamidopentyl)decanamido phosphonate" [] | xref | record_id "325" | xref | delta_mono_mass "572.316129" | xref | delta_avge_mass "572.7405" | xref | delta_composition "H(49) C(27) N(4) O(5) P S" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "users" | xref | date_time_posted "2005-05-19 22:01:37" | xref | date_time_modified "2010-02-24 20:54:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Y" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "K" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:327] === UNIMOD:327 Delta:H(4)C(2)O(-1)S(1) |
null .Term [UNIMOD:327] [cols="2*"] |
| id | UNIMOD:327 | name | Delta:H(4)C(2)O(-1)S(1) | def | "S-Ethylcystine from Serine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=327] | comment | Phosphoserine to S-ethylcystine via Beta elimination/Michael addition of ethylthiol. | xref | record_id "327" | xref | delta_mono_mass "44.008456" | xref | delta_avge_mass "44.1188" | xref | delta_composition "H(4) C(2) O(-1) S" | xref | username_of_poster "UCDMSF" | xref | group_of_poster "users" | xref | date_time_posted "2005-06-20 20:09:02" | xref | date_time_modified "2006-10-16 10:00:57" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:329] === UNIMOD:329 Methyl:2H(3)13C(1) |
null .Term [UNIMOD:329] [cols="2*"] |
| id | UNIMOD:329 | name | Methyl:2H(3)13C(1) | def | "Monomethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=329] | xref | record_id "329" | xref | delta_mono_mass "18.037835" | xref | delta_avge_mass "18.0377" | xref | delta_composition "H(-1) 2H(3) 13C" | xref | username_of_poster "sams" | xref | group_of_poster "users" | xref | date_time_posted "2005-06-30 18:19:34" | xref | date_time_modified "2016-06-14 11:54:23" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:330] === UNIMOD:330 Dimethyl:2H(6)13C(2) |
null .Term [UNIMOD:330] [cols="2*"] |
| id | UNIMOD:330 | name | Dimethyl:2H(6)13C(2) | def | "Dimethylation." [PMID:15782174, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=330] | xref | record_id "330" | xref | delta_mono_mass "36.07567" | xref | delta_avge_mass "36.0754" | xref | delta_composition "H(-2) 2H(6) 13C(2)" | xref | username_of_poster "sams" | xref | group_of_poster "users" | xref | date_time_posted "2005-06-30 18:21:32" | xref | date_time_modified "2014-11-16 07:36:47" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N-term" | xref | spec_4_position "Protein N-term" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "When dimethyl labelling is pre-digest" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:332] === UNIMOD:332 Thiophos-S-S-biotin |
null .Term [UNIMOD:332] [cols="2*"] |
| id | UNIMOD:332 | name | Thiophos-S-S-biotin | def | "Thiophosphate labeled with biotin-HPDP." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=332] | synonym | "Thiophos-biotin disulfide" [] | xref | record_id "332" | xref | delta_mono_mass "525.142894" | xref | delta_avge_mass "525.6658" | xref | delta_composition "H(34) C(19) N(4) O(5) P S(3)" | xref | username_of_poster "lparker" | xref | group_of_poster "users" | xref | date_time_posted "2005-07-21 16:37:10" | xref | date_time_modified "2006-10-16 17:02:42" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_neutral_loss_526_mono_mass "525.142894" | xref | spec_1_neutral_loss_526_avge_mass "525.6658" | xref | spec_1_neutral_loss_526_flag "false" | xref | spec_1_neutral_loss_526_composition "H(34) C(19) N(4) O(5) P S(3)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_neutral_loss_526_mono_mass "525.142894" | xref | spec_2_neutral_loss_526_avge_mass "525.6658" | xref | spec_2_neutral_loss_526_flag "false" | xref | spec_2_neutral_loss_526_composition "H(34) C(19) N(4) O(5) P S(3)" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_3_neutral_loss_526_mono_mass "525.142894" | xref | spec_3_neutral_loss_526_avge_mass "525.6658" | xref | spec_3_neutral_loss_526_flag "false" | xref | spec_3_neutral_loss_526_composition "H(34) C(19) N(4) O(5) P S(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:333] === UNIMOD:333 Can-FP-biotin |
null .Term [UNIMOD:333] [cols="2*"] |
| id | UNIMOD:333 | name | Can-FP-biotin | def | "6-N-biotinylaminohexyl isopropyl phosphate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=333] | comment | Commercially available from Toronto Research Chemicals Inc, as of 2005. Designed to label the active site serine of serine esterases/proteases. | synonym | "O-isopropyl-N-biotinylaminohexyl phosphonate" [] | xref | record_id "333" | xref | delta_mono_mass "447.195679" | xref | delta_avge_mass "447.5291" | xref | delta_composition "H(34) C(19) N(3) O(5) P S" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "users" | xref | date_time_posted "2005-07-21 20:54:00" | xref | date_time_modified "2010-12-03 16:24:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Y" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:335] === UNIMOD:335 HNE+Delta:H(2) |
null .Term [UNIMOD:335] [cols="2*"] |
| id | UNIMOD:335 | name | HNE+Delta:H(2) | def | "Reduced 4-Hydroxynonenal." [PMID:11910026, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=335] | comment | Michael addition adduct of 4-hydroxynonenal with histidine, cystein and lysine residues stabilized by reduction with NaBH4. | xref | record_id "335" | xref | delta_mono_mass "158.13068" | xref | delta_avge_mass "158.238" | xref | delta_composition "H(18) C(9) O(2)" | xref | username_of_poster "rkupfer" | xref | group_of_poster "users" | xref | date_time_posted "2005-08-10 20:52:36" | xref | date_time_modified "2011-07-18 11:28:34" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:337] === UNIMOD:337 Methylamine |
null .Term [UNIMOD:337] [cols="2*"] |
| id | UNIMOD:337 | name | Methylamine | def | "Michael addition with methylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=337] | xref | record_id "337" | xref | delta_mono_mass "13.031634" | xref | delta_avge_mass "13.0418" | xref | delta_composition "H(3) C N O(-1)" | xref | username_of_poster "zhulx" | xref | group_of_poster "users" | xref | date_time_posted "2005-08-12 21:55:51" | xref | date_time_modified "2006-10-14 10:02:51" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:340] === UNIMOD:340 Bromo |
null .Term [UNIMOD:340] [cols="2*"] |
| id | UNIMOD:340 | name | Bromo | def | "Bromination." [PMID:9033387, RESID:AA0174, RESID:AA0175, RESID:AA0176, RESID:AA0173, RESID:AA0180, RESID:AA0179, FindMod:BROM, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=340] | xref | record_id "340" | xref | delta_mono_mass "77.910511" | xref | delta_avge_mass "78.8961" | xref | delta_composition "H(-1) Br" | xref | username_of_poster "gerribe" | xref | group_of_poster "users" | xref | date_time_posted "2005-09-06 08:31:51" | xref | date_time_modified "2011-11-21 12:07:51" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "F" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "Y" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:342] === UNIMOD:342 Amino |
null .Term [UNIMOD:342] [cols="2*"] |
| id | UNIMOD:342 | name | Amino | def | "Tyrosine oxidation to 2-aminotyrosine." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=342] | xref | record_id "342" | xref | delta_mono_mass "15.010899" | xref | delta_avge_mass "15.0146" | xref | delta_composition "H N" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 21:18:23" | xref | date_time_modified "2006-10-14 10:39:53" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:343] === UNIMOD:343 Argbiotinhydrazide |
null .Term [UNIMOD:343] [cols="2*"] |
| id | UNIMOD:343 | name | Argbiotinhydrazide | def | "Oxidized Arginine biotinylated with biotin hydrazide." [PMID:15828771, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=343] | xref | record_id "343" | xref | delta_mono_mass "199.066699" | xref | delta_avge_mass "199.27" | xref | delta_composition "H(13) C(9) N O(2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:36:58" | xref | date_time_modified "2006-11-14 12:10:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:344] === UNIMOD:344 Arg→GluSA |
null .Term [UNIMOD:344] [cols="2*"] |
| id | UNIMOD:344 | name | Arg→GluSA | def | "Arginine oxidation to glutamic semialdehyde." [PMID:9252331, PMID:1680314, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=344] | synonym | "Arginine oxidation to gamma-glutamyl semialdehyde" [] | xref | record_id "344" | xref | delta_mono_mass "-43.053433" | xref | delta_avge_mass "-43.0711" | xref | delta_composition "H(-5) C(-1) N(-3) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:38:24" | xref | date_time_modified "2006-11-16 15:25:28" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:345] === UNIMOD:345 Trioxidation |
null .Term [UNIMOD:345] [cols="2*"] |
| id | UNIMOD:345 | name | Trioxidation | def | "Cysteine oxidation to cysteic acid." [PMID:14678012, PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=345] | xref | record_id "345" | xref | delta_mono_mass "47.984744" | xref | delta_avge_mass "47.9982" | xref | delta_composition "O(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:39:38" | xref | date_time_modified "2017-11-08 16:28:19" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "W" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "F" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:348] === UNIMOD:348 His→Asn |
null .Term [UNIMOD:348] [cols="2*"] |
| id | UNIMOD:348 | name | His→Asn | def | "His→Asn substitution." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=348] | synonym | "histidine oxidation to aspargine" [] | xref | record_id "348" | xref | delta_mono_mass "-23.015984" | xref | delta_avge_mass "-23.0366" | xref | delta_composition "H(-1) C(-2) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:43:27" | xref | date_time_modified "2011-06-23 12:00:22" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_1_misc_notes "Could also be classed as chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:349] === UNIMOD:349 His→Asp |
null .Term [UNIMOD:349] [cols="2*"] |
| id | UNIMOD:349 | name | His→Asp | def | "His→Asp substitution." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=349] | synonym | "histidine oxidation to aspartic acid" [] | xref | record_id "349" | xref | delta_mono_mass "-22.031969" | xref | delta_avge_mass "-22.0519" | xref | delta_composition "H(-2) C(-2) N(-2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:44:32" | xref | date_time_modified "2011-06-23 12:00:45" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_1_misc_notes "Could also be classed as chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:350] === UNIMOD:350 Trp→Hydroxykynurenin |
null .Term [UNIMOD:350] [cols="2*"] |
| id | UNIMOD:350 | name | Trp→Hydroxykynurenin | def | "Tryptophan oxidation to hydroxykynurenin." [URL:http\://www.lbqp.unb.br/bioq/htm/aulas2D/deg_aa_ile_leu_trp.htm?reload_coolmenus, PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=350] | xref | record_id "350" | xref | delta_mono_mass "19.989829" | xref | delta_avge_mass "19.9881" | xref | delta_composition "C(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:47:20" | xref | date_time_modified "2006-11-14 17:40:45" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:351] === UNIMOD:351 Trp→Kynurenin |
null .Term [UNIMOD:351] [cols="2*"] |
| id | UNIMOD:351 | name | Trp→Kynurenin | def | "Tryptophan oxidation to kynurenin." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=351] | xref | record_id "351" | xref | delta_mono_mass "3.994915" | xref | delta_avge_mass "3.9887" | xref | delta_composition "C(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:48:33" | xref | date_time_modified "2006-10-14 09:39:53" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:352] === UNIMOD:352 Lys→Allysine |
null .Term [UNIMOD:352] [cols="2*"] |
| id | UNIMOD:352 | name | Lys→Allysine | def | "Lysine oxidation to aminoadipic semialdehyde." [RESID:AA0121, FindMod:ALLYS, PMID:9252331, PMID:11120890, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=352] | xref | record_id "352" | xref | delta_mono_mass "-1.031634" | xref | delta_avge_mass "-1.0311" | xref | delta_composition "H(-3) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:49:59" | xref | date_time_modified "2006-10-13 18:27:28" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:353] === UNIMOD:353 Lysbiotinhydrazide |
null .Term [UNIMOD:353] [cols="2*"] |
| id | UNIMOD:353 | name | Lysbiotinhydrazide | def | "Oxidized Lysine biotinylated with biotin hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=353] | xref | record_id "353" | xref | delta_mono_mass "241.088497" | xref | delta_avge_mass "241.31" | xref | delta_composition "H(15) C(10) N(3) O(2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:51:13" | xref | date_time_modified "2006-11-14 12:12:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:354] === UNIMOD:354 Nitro |
null .Term [UNIMOD:354] [cols="2*"] |
| id | UNIMOD:354 | name | Nitro | def | "Oxidation to nitro." [PMID:8839040, PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=354] | xref | record_id "354" | xref | delta_mono_mass "44.985078" | xref | delta_avge_mass "44.9976" | xref | delta_composition "H(-1) N O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:52:38" | xref | date_time_modified "2017-11-08 16:26:39" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Y" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "F" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:357] === UNIMOD:357 probiotinhydrazide |
null .Term [UNIMOD:357] [cols="2*"] |
| id | UNIMOD:357 | name | probiotinhydrazide | def | "Oxidized proline biotinylated with biotin hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, PMID:15174056, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=357] | xref | record_id "357" | xref | delta_mono_mass "258.115047" | xref | delta_avge_mass "258.3405" | xref | delta_composition "H(18) C(10) N(4) O(2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:56:20" | xref | date_time_modified "2006-11-14 12:12:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:359] === UNIMOD:359 Pro→pyro-Glu |
null .Term [UNIMOD:359] [cols="2*"] |
| id | UNIMOD:359 | name | Pro→pyro-Glu | def | "Proline oxidation to pyroglutamic acid." [PMID:9252331, PMID:10717661, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=359] | xref | record_id "359" | xref | delta_mono_mass "13.979265" | xref | delta_avge_mass "13.9835" | xref | delta_composition "H(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 22:58:42" | xref | date_time_modified "2006-10-14 10:03:34" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:360] === UNIMOD:360 Pro→Pyrrolidinone |
null .Term [UNIMOD:360] [cols="2*"] |
| id | UNIMOD:360 | name | Pro→Pyrrolidinone | def | "Proline oxidation to pyrrolidinone." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=360] | xref | record_id "360" | xref | delta_mono_mass "-30.010565" | xref | delta_avge_mass "-30.026" | xref | delta_composition "H(-2) C(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 23:00:19" | xref | date_time_modified "2006-10-13 15:37:42" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:361] === UNIMOD:361 Thrbiotinhydrazide |
null .Term [UNIMOD:361] [cols="2*"] |
| id | UNIMOD:361 | name | Thrbiotinhydrazide | def | "Oxidized Threonine biotinylated with biotin hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=361] | xref | record_id "361" | xref | delta_mono_mass "240.104482" | xref | delta_avge_mass "240.3252" | xref | delta_composition "H(16) C(10) N(4) O S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-09-10 23:01:28" | xref | date_time_modified "2006-11-14 12:12:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:362] === UNIMOD:362 Diisopropylphosphate |
null .Term [UNIMOD:362] [cols="2*"] |
| id | UNIMOD:362 | name | Diisopropylphosphate | def | "O-Diisopropylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=362] | comment | A selective label for the active site serine of the serine esterase/protease family. It has also been shown to label tyrosine in serum albumin. | xref | record_id "362" | xref | delta_mono_mass "164.060231" | xref | delta_avge_mass "164.1394" | xref | delta_composition "H(13) C(6) O(3) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "users" | xref | date_time_posted "2005-09-14 18:05:04" | xref | date_time_modified "2011-12-05 16:14:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "K" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "N-term" | xref | spec_5_position "Any N-term" | xref | spec_5_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:363] === UNIMOD:363 Isopropylphospho |
null .Term [UNIMOD:363] [cols="2*"] |
| id | UNIMOD:363 | name | Isopropylphospho | def | "O-Isopropylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=363] | comment | Created by auto-catalytic dealkylation of the O-Diisopropylphosphate adduct. | xref | record_id "363" | xref | delta_mono_mass "122.013281" | xref | delta_avge_mass "122.0596" | xref | delta_composition "H(7) C(3) O(3) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "users" | xref | date_time_posted "2005-09-14 18:08:20" | xref | date_time_modified "2007-01-15 15:25:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:364] === UNIMOD:364 ICPL:13C(6) |
null .Term [UNIMOD:364] [cols="2*"] |
| id | UNIMOD:364 | name | ICPL:13C(6) | def | "Bruker Daltonics SERVA-ICPL™ quantification chemistry, heavy form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=364] | comment | Attention: As the digest is typically applied AFTER ICPL_light/heavy labeling, only ProteinN-term labeling and Lys-specific labeling is applied. | xref | record_id "364" | xref | delta_mono_mass "111.041593" | xref | delta_avge_mass "111.05" | xref | delta_composition "H(3) 13C(6) N O" | xref | username_of_poster "suckau" | xref | group_of_poster "users" | xref | date_time_posted "2005-09-19 12:45:52" | xref | date_time_modified "2008-09-03 15:27:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_misc_notes "Use when labelling pre-digest" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Use when labelling post-digest" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:365] === UNIMOD:365 ICPL |
null .Term [UNIMOD:365] [cols="2*"] |
| id | UNIMOD:365 | name | ICPL | def | "Bruker Daltonics SERVA-ICPL™ quantification chemistry, light form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=365] | comment | Attention: As the digest is typically applied AFTER ICPL_light/heavy labeling, only ProteinN-term labeling and Lys-specific labeling is applied. | xref | record_id "365" | xref | delta_mono_mass "105.021464" | xref | delta_avge_mass "105.0941" | xref | delta_composition "H(3) C(6) N O" | xref | username_of_poster "suckau" | xref | group_of_poster "users" | xref | date_time_posted "2005-09-19 13:00:14" | xref | date_time_modified "2008-09-03 15:26:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_misc_notes "Use when labelling pre-digest" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Use when labelling post-digest" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:366] === UNIMOD:366 Deamidated:18O(1) |
null .Term [UNIMOD:366] [cols="2*"] |
| id | UNIMOD:366 | name | Deamidated:18O(1) | def | "Deamidation in presence of O18." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=366] | comment | Observed. | xref | record_id "366" | xref | delta_mono_mass "2.988261" | xref | delta_avge_mass "2.9845" | xref | delta_composition "H(-1) N(-1) 18O" | xref | username_of_poster "gerribe" | xref | group_of_poster "users" | xref | date_time_posted "2005-09-22 15:30:16" | xref | date_time_modified "2006-10-14 09:35:33" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:368] === UNIMOD:368 Cys→Dha |
null .Term [UNIMOD:368] [cols="2*"] |
| id | UNIMOD:368 | name | Cys→Dha | def | "Dehydroalanine (from Cysteine)." [PMID:11212008, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=368] | xref | record_id "368" | xref | delta_mono_mass "-33.987721" | xref | delta_avge_mass "-34.0809" | xref | delta_composition "H(-2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-02 17:31:11" | xref | date_time_modified "2006-10-13 15:27:46" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:369] === UNIMOD:369 Pro→Pyrrolidone |
null .Term [UNIMOD:369] [cols="2*"] |
| id | UNIMOD:369 | name | Pro→Pyrrolidone | def | "Pyrrolidone from Proline." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=369] | xref | record_id "369" | xref | delta_mono_mass "-27.994915" | xref | delta_avge_mass "-28.0101" | xref | delta_composition "C(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-02 17:39:05" | xref | date_time_modified "2006-11-14 11:12:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:371] === UNIMOD:371 HMVK |
null .Term [UNIMOD:371] [cols="2*"] |
| id | UNIMOD:371 | name | HMVK | def | "Michael addition of hydroxymethylvinyl ketone to cysteine." [PMID:11743741, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=371] | synonym | "hydroxymethylvinyl ketone" [] | xref | record_id "371" | xref | delta_mono_mass "86.036779" | xref | delta_avge_mass "86.0892" | xref | delta_composition "H(6) C(4) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-03 15:59:33" | xref | date_time_modified "2006-10-16 12:15:35" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:372] === UNIMOD:372 Arg→Orn |
null .Term [UNIMOD:372] [cols="2*"] |
| id | UNIMOD:372 | name | Arg→Orn | def | "Ornithine from Arginine." [PMID:15489230, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=372] | xref | record_id "372" | xref | delta_mono_mass "-42.021798" | xref | delta_avge_mass "-42.04" | xref | delta_composition "H(-2) C(-1) N(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-05 17:55:25" | xref | date_time_modified "2006-10-13 15:26:33" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:374] === UNIMOD:374 Dehydro |
null .Term [UNIMOD:374] [cols="2*"] |
| id | UNIMOD:374 | name | Dehydro | def | "Half of a disulfide bridge." [RESID:AA0025, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=374] | xref | record_id "374" | xref | delta_mono_mass "-1.007825" | xref | delta_avge_mass "-1.0079" | xref | delta_composition "H(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-06 20:57:01" | xref | date_time_modified "2006-10-13 18:28:17" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:375] === UNIMOD:375 Diphthamide |
null .Term [UNIMOD:375] [cols="2*"] |
| id | UNIMOD:375 | name | Diphthamide | def | "Diphthamide." [RESID:AA0040, FindMod:DIPH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=375] | xref | record_id "375" | xref | delta_mono_mass "142.110613" | xref | delta_avge_mass "142.1989" | xref | delta_composition "H(14) C(7) N(2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-06 23:21:29" | xref | date_time_modified "2015-09-08 17:15:11" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:376] === UNIMOD:376 Hydroxyfarnesyl |
null .Term [UNIMOD:376] [cols="2*"] |
| id | UNIMOD:376 | name | Hydroxyfarnesyl | def | "Hydroxyfarnesyl." [RESID:AA0103, FindMod:FAR0, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=376] | xref | record_id "376" | xref | delta_mono_mass "220.182715" | xref | delta_avge_mass "220.3505" | xref | delta_composition "H(24) C(15) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-07 20:36:20" | xref | date_time_modified "2006-10-16 15:20:11" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:377] === UNIMOD:377 Diacylglycerol |
null .Term [UNIMOD:377] [cols="2*"] |
| id | UNIMOD:377 | name | Diacylglycerol | def | "Diacylglycerol." [RESID:AA0107, FindMod:DIAC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=377] | xref | record_id "377" | xref | delta_mono_mass "576.511761" | xref | delta_avge_mass "576.9334" | xref | delta_composition "H(68) C(37) O(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-07 20:41:21" | xref | date_time_modified "2006-10-16 17:05:40" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:378] === UNIMOD:378 Carboxyethyl |
null .Term [UNIMOD:378] [cols="2*"] |
| id | UNIMOD:378 | name | Carboxyethyl | def | "Carboxyethyl." [RESID:AA0115, FindMod:CETH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=378] | xref | record_id "378" | xref | delta_mono_mass "72.021129" | xref | delta_avge_mass "72.0627" | xref | delta_composition "H(4) C(3) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-07 22:18:20" | xref | date_time_modified "2012-09-19 22:24:05" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "Labeling with diethylpyrocarbonate (DEPC)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:379] === UNIMOD:379 Hypusine |
null .Term [UNIMOD:379] [cols="2*"] |
| id | UNIMOD:379 | name | Hypusine | def | "Hypusine." [RESID:AA0116, FindMod:HYPU, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=379] | xref | record_id "379" | xref | delta_mono_mass "87.068414" | xref | delta_avge_mass "87.1204" | xref | delta_composition "H(9) C(4) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-07 22:20:53" | xref | date_time_modified "2006-10-16 12:35:24" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:380] === UNIMOD:380 Retinylidene |
null .Term [UNIMOD:380] [cols="2*"] |
| id | UNIMOD:380 | name | Retinylidene | def | "Retinal." [RESID:AA0120, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=380] | xref | record_id "380" | xref | delta_mono_mass "266.203451" | xref | delta_avge_mass "266.4204" | xref | delta_composition "H(26) C(20)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-07 22:27:27" | xref | date_time_modified "2006-10-16 15:47:14" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:381] === UNIMOD:381 Lys→AminoadipicAcid |
null .Term [UNIMOD:381] [cols="2*"] |
| id | UNIMOD:381 | name | Lys→AminoadipicAcid | def | "Alpha-amino adipic acid." [RESID:AA0122, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=381] | xref | record_id "381" | xref | delta_mono_mass "14.96328" | xref | delta_avge_mass "14.9683" | xref | delta_composition "H(-3) N(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 17:41:37" | xref | date_time_modified "2006-10-14 10:33:11" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:382] === UNIMOD:382 Cys→PyruvicAcid |
null .Term [UNIMOD:382] [cols="2*"] |
| id | UNIMOD:382 | name | Cys→PyruvicAcid | def | "Pyruvic acid from N-term cys." [RESID:AA0127, FindMod:PYRUC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=382] | xref | record_id "382" | xref | delta_mono_mass "-33.003705" | xref | delta_avge_mass "-33.0961" | xref | delta_composition "H(-3) N(-1) O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 17:48:42" | xref | date_time_modified "2006-10-13 16:42:55" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:385] === UNIMOD:385 Ammonia-loss |
null .Term [UNIMOD:385] [cols="2*"] |
| id | UNIMOD:385 | name | Ammonia-loss | def | "Loss of ammonia." [RESID:AA0127, FindMod:PYRUS, RESID:AA0129, FindMod:OXOB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=385] | synonym | "oxobutanoic acid from N term Thr pyruvic acid from N-term ser" [] | xref | record_id "385" | xref | delta_mono_mass "-17.026549" | xref | delta_avge_mass "-17.0305" | xref | delta_composition "H(-3) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 18:00:01" | xref | date_time_modified "2007-07-15 20:11:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "0" | xref | spec_3_site "C" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | xref | spec_3_misc_notes "Pyro-carbamidomethyl as a delta from Carbamidomethyl-Cys" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_4_misc_notes "N-Succinimide" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:387] === UNIMOD:387 Phycocyanobilin |
null .Term [UNIMOD:387] [cols="2*"] |
| id | UNIMOD:387 | name | Phycocyanobilin | def | "Phycocyanobilin." [RESID:AA0258, RESID:AA0131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=387] | comment | Phycocyanobilin and phycobiliviolin have different structures but the same empirical formula. | synonym | "phycobiliviolin" [] | xref | record_id "387" | xref | delta_mono_mass "586.279135" | xref | delta_avge_mass "586.678" | xref | delta_composition "H(38) C(33) N(4) O(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 18:06:19" | xref | date_time_modified "2006-10-16 17:07:44" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:388] === UNIMOD:388 Phycoerythrobilin |
null .Term [UNIMOD:388] [cols="2*"] |
| id | UNIMOD:388 | name | Phycoerythrobilin | def | "Phycoerythrobilin." [RESID:AA0132, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=388] | xref | record_id "388" | xref | delta_mono_mass "588.294785" | xref | delta_avge_mass "588.6939" | xref | delta_composition "H(40) C(33) N(4) O(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 18:08:38" | xref | date_time_modified "2006-10-16 17:08:02" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:389] === UNIMOD:389 Phytochromobilin |
null .Term [UNIMOD:389] [cols="2*"] |
| id | UNIMOD:389 | name | Phytochromobilin | def | "Phytochromobilin." [RESID:AA0133, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=389] | xref | record_id "389" | xref | delta_mono_mass "584.263485" | xref | delta_avge_mass "584.6621" | xref | delta_composition "H(36) C(33) N(4) O(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 18:23:58" | xref | date_time_modified "2006-10-16 17:07:22" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:390] === UNIMOD:390 Heme |
null .Term [UNIMOD:390] [cols="2*"] |
| id | UNIMOD:390 | name | Heme | def | "Heme." [RESID:AA0329, RESID:AA0135, RESID:AA0276, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=390] | xref | record_id "390" | xref | delta_mono_mass "616.177295" | xref | delta_avge_mass "616.4873" | xref | delta_composition "H(32) C(34) N(4) O(4) Fe" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 18:27:20" | xref | date_time_modified "2006-10-16 17:10:28" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:391] === UNIMOD:391 Molybdopterin |
null .Term [UNIMOD:391] [cols="2*"] |
| id | UNIMOD:391 | name | Molybdopterin | def | "Molybdopterin." [RESID:AA0142, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=391] | xref | record_id "391" | xref | delta_mono_mass "521.884073" | xref | delta_avge_mass "520.2668" | xref | delta_composition "H(11) C(10) N(5) O(8) P S(2) Mo" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 18:46:19" | xref | date_time_modified "2006-10-16 17:02:25" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:392] === UNIMOD:392 Quinone |
null .Term [UNIMOD:392] [cols="2*"] |
| id | UNIMOD:392 | name | Quinone | def | "Quinone." [RESID:AA0147, RESID:AA0148, FindMod:TOPA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=392] | xref | record_id "392" | xref | delta_mono_mass "29.974179" | xref | delta_avge_mass "29.9829" | xref | delta_composition "H(-2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 18:56:28" | xref | date_time_modified "2006-10-15 18:03:47" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "W" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:393] === UNIMOD:393 Glucosylgalactosyl |
null .Term [UNIMOD:393] [cols="2*"] |
| id | UNIMOD:393 | name | Glucosylgalactosyl | def | "Glucosylgalactosyl hydroxylysine." [RESID:AA0153, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=393] | xref | record_id "393" | xref | delta_mono_mass "340.100562" | xref | delta_avge_mass "340.2806" | xref | delta_composition "O Hex(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 19:19:13" | xref | date_time_modified "2015-05-01 14:08:37" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | xref | spec_1_neutral_loss_341_mono_mass "340.100562" | xref | spec_1_neutral_loss_341_avge_mass "340.2806" | xref | spec_1_neutral_loss_341_flag "false" | xref | spec_1_neutral_loss_341_composition "O Hex(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:394] === UNIMOD:394 GPIanchor |
null .Term [UNIMOD:394] [cols="2*"] |
| id | UNIMOD:394 | name | GPIanchor | def | "Glycosylphosphatidylinositol." [RESID:AA0158, RESID:AA0159, RESID:AA0160, RESID:AA0161, RESID:AA0162, RESID:AA0163, RESID:AA0164, RESID:AA0165, RESID:AA0166, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=394] | xref | record_id "394" | xref | delta_mono_mass "123.00853" | xref | delta_avge_mass "123.0477" | xref | delta_composition "H(6) C(2) N O(3) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 19:31:10" | xref | date_time_modified "2006-11-14 11:13:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:395] === UNIMOD:395 PhosphoribosyldephosphoCoA |
null .Term [UNIMOD:395] [cols="2*"] |
| id | UNIMOD:395 | name | PhosphoribosyldephosphoCoA | def | "Phosphoribosyl dephospho-coenzyme A." [RESID:AA0167, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=395] | xref | record_id "395" | xref | delta_mono_mass "881.146904" | xref | delta_avge_mass "881.6335" | xref | delta_composition "H(42) C(26) N(7) O(19) P(3) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 19:42:56" | xref | date_time_modified "2006-10-16 17:19:42" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:396] === UNIMOD:396 GlycerylPE |
null .Term [UNIMOD:396] [cols="2*"] |
| id | UNIMOD:396 | name | GlycerylPE | def | "Glycerylphosphorylethanolamine." [RESID:AA0170, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=396] | xref | record_id "396" | xref | delta_mono_mass "197.04531" | xref | delta_avge_mass "197.1262" | xref | delta_composition "H(12) C(5) N O(5) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 19:50:17" | xref | date_time_modified "2006-10-16 15:08:39" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:397] === UNIMOD:397 Triiodothyronine |
null .Term [UNIMOD:397] [cols="2*"] |
| id | UNIMOD:397 | name | Triiodothyronine | def | "Triiodo." [RESID:AA0177, FindMod:THRN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=397] | xref | record_id "397" | xref | delta_mono_mass "469.716159" | xref | delta_avge_mass "469.785" | xref | delta_composition "H C(6) O I(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 20:08:28" | xref | date_time_modified "2006-10-16 16:59:19" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:398] === UNIMOD:398 Thyroxine |
null .Term [UNIMOD:398] [cols="2*"] |
| id | UNIMOD:398 | name | Thyroxine | def | "Tetraiodo." [RESID:AA0178, FindMod:THRX, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=398] | xref | record_id "398" | xref | delta_mono_mass "595.612807" | xref | delta_avge_mass "595.6815" | xref | delta_composition "C(6) O I(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 20:10:14" | xref | date_time_modified "2006-10-16 17:08:51" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:400] === UNIMOD:400 Tyr→Dha |
null .Term [UNIMOD:400] [cols="2*"] |
| id | UNIMOD:400 | name | Tyr→Dha | def | "Dehydroalanine (from Tyrosine)." [RESID:AA0181, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=400] | xref | record_id "400" | xref | delta_mono_mass "-94.041865" | xref | delta_avge_mass "-94.1112" | xref | delta_composition "H(-6) C(-6) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 20:17:48" | xref | date_time_modified "2006-10-13 15:02:50" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:401] === UNIMOD:401 Didehydro |
null .Term [UNIMOD:401] [cols="2*"] |
| id | UNIMOD:401 | name | Didehydro | def | "2-amino-3-oxo-butanoic_acid." [RESID:AA0183, RESID:AA0185, PMID:9252331, RESID:AA0365, FindMod:OXOAS, FindMod:DHY, PMID:15705169, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=401] | synonym | "oxoalanine" [] | xref | record_id "401" | xref | delta_mono_mass "-2.01565" | xref | delta_avge_mass "-2.0159" | xref | delta_composition "H(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 20:23:58" | xref | date_time_modified "2008-07-30 12:01:47" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_2_misc_notes "oxoalanine formylglycine" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "K" | xref | spec_4_position "Any C-term" | xref | spec_4_classification "Artefact" | xref | spec_4_misc_notes "Lactone formation from C-terminal hydroxylysine" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:402] === UNIMOD:402 Cys→Oxoalanine |
null .Term [UNIMOD:402] [cols="2*"] |
| id | UNIMOD:402 | name | Cys→Oxoalanine | def | "Oxoalanine." [RESID:AA0185, FindMod:OXOAC, PMID:18722427, PMID:17450134, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=402] | synonym | "formylglycine" [] | xref | record_id "402" | xref | delta_mono_mass "-17.992806" | xref | delta_avge_mass "-18.0815" | xref | delta_composition "H(-2) O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 20:29:10" | xref | date_time_modified "2009-03-13 16:04:03" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:403] === UNIMOD:403 Ser→LacticAcid |
null .Term [UNIMOD:403] [cols="2*"] |
| id | UNIMOD:403 | name | Ser→LacticAcid | def | "Lactic acid from N-term Ser." [RESID:AA0186, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=403] | xref | record_id "403" | xref | delta_mono_mass "-15.010899" | xref | delta_avge_mass "-15.0146" | xref | delta_composition "H(-1) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 20:34:16" | xref | date_time_modified "2006-10-13 17:18:52" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:405] === UNIMOD:405 Phosphoadenosine |
null .Term [UNIMOD:405] [cols="2*"] |
| id | UNIMOD:405 | name | Phosphoadenosine | def | "AMP." [RESID:AA0371, RESID:AA0227, RESID:AA0203, RESID:AA0267, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=405] | xref | record_id "405" | xref | delta_mono_mass "329.05252" | xref | delta_avge_mass "329.2059" | xref | delta_composition "H(12) C(10) N(5) O(6) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 21:34:01" | xref | date_time_modified "2020-02-25 09:39:30" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:407] === UNIMOD:407 Hydroxycinnamyl |
null .Term [UNIMOD:407] [cols="2*"] |
| id | UNIMOD:407 | name | Hydroxycinnamyl | def | "Hydroxycinnamyl." [RESID:AA0207, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=407] | xref | record_id "407" | xref | delta_mono_mass "146.036779" | xref | delta_avge_mass "146.1427" | xref | delta_composition "H(6) C(9) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 21:40:43" | xref | date_time_modified "2006-10-16 14:02:07" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:408] === UNIMOD:408 Glycosyl |
null .Term [UNIMOD:408] [cols="2*"] |
| id | UNIMOD:408 | name | Glycosyl | def | "Glycosyl-L-hydroxyproline." [RESID:AA0212, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=408] | xref | record_id "408" | xref | delta_mono_mass "148.037173" | xref | delta_avge_mass "148.114" | xref | delta_composition "H(-2) C(-1) Hex" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 21:57:16" | xref | date_time_modified "2015-05-01 13:14:26" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:409] === UNIMOD:409 FMNH |
null .Term [UNIMOD:409] [cols="2*"] |
| id | UNIMOD:409 | name | FMNH | def | "Flavin mononucleotide." [RESID:AA0353, RESID:AA0220, RESID:AA0352, FindMod:FMNH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=409] | xref | record_id "409" | xref | delta_mono_mass "454.088965" | xref | delta_avge_mass "454.3279" | xref | delta_composition "H(19) C(17) N(4) O(9) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 22:09:45" | xref | date_time_modified "2006-10-16 16:57:46" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:410] === UNIMOD:410 Archaeol |
null .Term [UNIMOD:410] [cols="2*"] |
| id | UNIMOD:410 | name | Archaeol | def | "S-diphytanylglycerol diether." [RESID:AA0223, FindMod:ARCH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=410] | xref | record_id "410" | xref | delta_mono_mass "634.662782" | xref | delta_avge_mass "635.1417" | xref | delta_composition "H(86) C(43) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-11 22:15:37" | xref | date_time_modified "2006-10-16 17:10:59" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:411] === UNIMOD:411 Phenylisocyanate |
null .Term [UNIMOD:411] [cols="2*"] |
| id | UNIMOD:411 | name | Phenylisocyanate | def | "Phenyl isocyanate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=411] | xref | record_id "411" | xref | delta_mono_mass "119.037114" | xref | delta_avge_mass "119.1207" | xref | delta_composition "H(5) C(7) N O" | xref | username_of_poster "TING" | xref | group_of_poster "users" | xref | date_time_posted "2005-10-14 21:13:16" | xref | date_time_modified "2006-10-16 12:48:08" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:412] === UNIMOD:412 Phenylisocyanate:2H(5) |
null .Term [UNIMOD:412] [cols="2*"] |
| id | UNIMOD:412 | name | Phenylisocyanate:2H(5) | def | "D5-phenyl isocyanate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=412] | xref | record_id "412" | xref | delta_mono_mass "124.068498" | xref | delta_avge_mass "124.1515" | xref | delta_composition "2H(5) C(7) N O" | xref | username_of_poster "TING" | xref | group_of_poster "users" | xref | date_time_posted "2005-10-14 21:16:11" | xref | date_time_modified "2006-10-16 13:35:26" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:413] === UNIMOD:413 Phosphoguanosine |
null .Term [UNIMOD:413] [cols="2*"] |
| id | UNIMOD:413 | name | Phosphoguanosine | def | "Phospho-guanosine." [RESID:AA0325, RESID:AA0228, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=413] | xref | record_id "413" | xref | delta_mono_mass "345.047435" | xref | delta_avge_mass "345.2053" | xref | delta_composition "H(12) C(10) N(5) O(7) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 15:50:03" | xref | date_time_modified "2006-10-16 16:01:42" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:414] === UNIMOD:414 Hydroxymethyl |
null .Term [UNIMOD:414] [cols="2*"] |
| id | UNIMOD:414 | name | Hydroxymethyl | def | "Hydroxymethyl." [RESID:AA0236, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=414] | xref | record_id "414" | xref | delta_mono_mass "30.010565" | xref | delta_avge_mass "30.026" | xref | delta_composition "H(2) C O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 16:12:56" | xref | date_time_modified "2006-10-15 18:04:18" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:415] === UNIMOD:415 MolybdopterinGD+Delta:S(-1)Se(1) |
null .Term [UNIMOD:415] [cols="2*"] |
| id | UNIMOD:415 | name | MolybdopterinGD+Delta:S(-1)Se(1) | def | "L-selenocysteinyl molybdenum bis(molybdopterin guanine dinucleotide)." [RESID:AA0248, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=415] | xref | record_id "415" | xref | delta_mono_mass "1620.930224" | xref | delta_avge_mass "1618.9096" | xref | delta_composition "H(47) C(40) N(20) O(26) P(4) S(3) Se Mo" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 16:27:56" | xref | date_time_modified "2006-10-17 11:44:58" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:416] === UNIMOD:416 Dipyrrolylmethanemethyl |
null .Term [UNIMOD:416] [cols="2*"] |
| id | UNIMOD:416 | name | Dipyrrolylmethanemethyl | def | "Dipyrrolylmethanemethyl." [RESID:AA0252, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=416] | xref | record_id "416" | xref | delta_mono_mass "418.137616" | xref | delta_avge_mass "418.3973" | xref | delta_composition "H(22) C(20) N(2) O(8)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 16:33:24" | xref | date_time_modified "2006-11-14 10:37:01" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:417] === UNIMOD:417 PhosphoUridine |
null .Term [UNIMOD:417] [cols="2*"] |
| id | UNIMOD:417 | name | PhosphoUridine | def | "Uridine phosphodiester." [RESID:AA0256, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=417] | xref | record_id "417" | xref | delta_mono_mass "306.025302" | xref | delta_avge_mass "306.166" | xref | delta_composition "H(11) C(9) N(2) O(8) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 16:38:18" | xref | date_time_modified "2006-10-16 15:52:11" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:419] === UNIMOD:419 Glycerophospho |
null .Term [UNIMOD:419] [cols="2*"] |
| id | UNIMOD:419 | name | Glycerophospho | def | "Glycerophospho." [RESID:AA0264, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=419] | xref | record_id "419" | xref | delta_mono_mass "154.00311" | xref | delta_avge_mass "154.0584" | xref | delta_composition "H(7) C(3) O(5) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 17:02:51" | xref | date_time_modified "2006-10-16 14:03:40" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:420] === UNIMOD:420 Carboxy→Thiocarboxy |
null .Term [UNIMOD:420] [cols="2*"] |
| id | UNIMOD:420 | name | Carboxy→Thiocarboxy | def | "Thiocarboxylic acid." [FindMod:THIOG, RESID:AA0265, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=420] | xref | record_id "420" | xref | delta_mono_mass "15.977156" | xref | delta_avge_mass "16.0656" | xref | delta_composition "O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 17:08:53" | xref | date_time_modified "2006-10-14 10:59:20" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:421] === UNIMOD:421 Sulfide |
null .Term [UNIMOD:421] [cols="2*"] |
| id | UNIMOD:421 | name | Sulfide | def | "Persulfide." [RESID:AA0269, URL:http\://www.nestgrp.com/protocols/bmt/pi3tr.shtml, FindMod:CYSP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=421] | xref | record_id "421" | xref | delta_mono_mass "31.972071" | xref | delta_avge_mass "32.065" | xref | delta_composition "S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 17:22:45" | xref | date_time_modified "2012-11-23 11:25:27" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_2_misc_notes "beta-thiolation" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "W" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_3_misc_notes "Addition of a single sulfur atom by Pi3-Tryptophan reagent to create thiol" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:422] === UNIMOD:422 PyruvicAcidIminyl |
null .Term [UNIMOD:422] [cols="2*"] |
| id | UNIMOD:422 | name | PyruvicAcidIminyl | def | "N-pyruvic acid 2-iminyl." [RESID:AA0287, RESID:AA0274, RESID:AA0275, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=422] | xref | record_id "422" | xref | delta_mono_mass "70.005479" | xref | delta_avge_mass "70.0468" | xref | delta_composition "H(2) C(3) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 17:30:48" | xref | date_time_modified "2006-10-16 10:35:08" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "V" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:423] === UNIMOD:423 Delta:Se(1) |
null .Term [UNIMOD:423] [cols="2*"] |
| id | UNIMOD:423 | name | Delta:Se(1) | def | "Selenyl." [RESID:AA0277, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=423] | xref | record_id "423" | xref | delta_mono_mass "79.91652" | xref | delta_avge_mass "78.96" | xref | delta_composition "Se" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 17:49:48" | xref | date_time_modified "2006-10-16 11:14:44" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:424] === UNIMOD:424 MolybdopterinGD |
null .Term [UNIMOD:424] [cols="2*"] |
| id | UNIMOD:424 | name | MolybdopterinGD | def | "Molybdenum bis(molybdopterin guanine dinucleotide)." [RESID:AA0375, RESID:AA0281, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=424] | xref | record_id "424" | xref | delta_mono_mass "1572.985775" | xref | delta_avge_mass "1572.0146" | xref | delta_composition "H(47) C(40) N(20) O(26) P(4) S(4) Mo" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 17:53:48" | xref | date_time_modified "2016-02-01 14:23:12" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "U" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:425] === UNIMOD:425 Dioxidation |
null .Term [UNIMOD:425] [cols="2*"] |
| id | UNIMOD:425 | name | Dioxidation | def | "Dihydroxy." [PMID:9252331, RESID:AA0282, RESID:AA0370, FindMod:DIHYDR, FindMod:MSONE, FindMod:CSIA, PMID:12686488, RESID:AA0262, RESID:AA0369, RESID:AA0263, RESID:AA0251, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=425] | xref | record_id "425" | xref | delta_mono_mass "31.989829" | xref | delta_avge_mass "31.9988" | xref | delta_composition "O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 17:59:33" | xref | date_time_modified "2017-11-03 09:33:41" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_4_group "4" | xref | spec_4_hidden "0" | xref | spec_4_site "M" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Post-translational" | xref | spec_4_misc_notes "Sulphone" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "F" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_5_misc_notes "phenylalanine oxidation to dihydroxyphenylalanine" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "W" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | xref | spec_6_misc_notes "tryptophan oxidation to formylkynurenin" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "Y" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Post-translational" | xref | spec_7_misc_notes "trihydroxyphenylalanine" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "C" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Post-translational" | xref | spec_8_misc_notes "sulfinic acid" | xref | spec_9_group "9" | xref | spec_9_hidden "1" | xref | spec_9_site "U" | xref | spec_9_position "Anywhere" | xref | spec_9_classification "Multiple" | xref | spec_10_group "10" | xref | spec_10_hidden "1" | xref | spec_10_site "E" | xref | spec_10_position "Anywhere" | xref | spec_10_classification "Chemical derivative" | xref | spec_11_group "11" | xref | spec_11_hidden "1" | xref | spec_11_site "I" | xref | spec_11_position "Anywhere" | xref | spec_11_classification "Chemical derivative" | xref | spec_12_group "12" | xref | spec_12_hidden "1" | xref | spec_12_site "L" | xref | spec_12_position "Anywhere" | xref | spec_12_classification "Chemical derivative" | xref | spec_13_group "13" | xref | spec_13_hidden "1" | xref | spec_13_site "V" | xref | spec_13_position "Anywhere" | xref | spec_13_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:426] === UNIMOD:426 Octanoyl |
null .Term [UNIMOD:426] [cols="2*"] |
| id | UNIMOD:426 | name | Octanoyl | def | "Octanoyl." [RESID:AA0290, RESID:AA0386, FindMod:OCTA, RESID:AA0584, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=426] | xref | record_id "426" | xref | delta_mono_mass "126.104465" | xref | delta_avge_mass "126.1962" | xref | delta_composition "H(14) C(8) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 18:04:46" | xref | date_time_modified "2013-03-07 10:09:12" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "C" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:428] === UNIMOD:428 PhosphoHexNAc |
null .Term [UNIMOD:428] [cols="2*"] |
| id | UNIMOD:428 | name | PhosphoHexNAc | def | "N-acetylglucosamine-1-phosphoryl." [RESID:AA0296, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=428] | xref | record_id "428" | xref | delta_mono_mass "283.045704" | xref | delta_avge_mass "283.1724" | xref | delta_composition "H O(3) P HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 18:15:16" | xref | date_time_modified "2015-05-01 15:11:15" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_284_mono_mass "283.045704" | xref | spec_1_neutral_loss_284_avge_mass "283.1724" | xref | spec_1_neutral_loss_284_flag "false" | xref | spec_1_neutral_loss_284_composition "H O(3) P HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_284_mono_mass "283.045704" | xref | spec_1_neutral_loss_284_avge_mass "283.1724" | xref | spec_1_neutral_loss_284_flag "false" | xref | spec_1_neutral_loss_284_composition "H O(3) P HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:429] === UNIMOD:429 PhosphoHex |
null .Term [UNIMOD:429] [cols="2*"] |
| id | UNIMOD:429 | name | PhosphoHex | def | "Phosphoglycosyl-D-mannose-1-phosphoryl." [RESID:AA0297, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=429] | xref | record_id "429" | xref | delta_mono_mass "242.019154" | xref | delta_avge_mass "242.1205" | xref | delta_composition "H O(3) P Hex" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 18:18:51" | xref | date_time_modified "2015-05-01 15:09:57" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_243_mono_mass "242.019154" | xref | spec_1_neutral_loss_243_avge_mass "242.1205" | xref | spec_1_neutral_loss_243_flag "false" | xref | spec_1_neutral_loss_243_composition "H O(3) P Hex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_243_mono_mass "242.019154" | xref | spec_1_neutral_loss_243_avge_mass "242.1205" | xref | spec_1_neutral_loss_243_flag "false" | xref | spec_1_neutral_loss_243_composition "H O(3) P Hex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:431] === UNIMOD:431 Palmitoleyl |
null .Term [UNIMOD:431] [cols="2*"] |
| id | UNIMOD:431 | name | Palmitoleyl | def | "Palmitoleyl." [RESID:AA0308, FindMod:PALE, PMID:17141155, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=431] | xref | record_id "431" | xref | delta_mono_mass "236.214016" | xref | delta_avge_mass "236.3929" | xref | delta_composition "H(28) C(16) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 19:57:30" | xref | date_time_modified "2009-06-21 21:18:50" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Pre-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:432] === UNIMOD:432 Cholesterol |
null .Term [UNIMOD:432] [cols="2*"] |
| id | UNIMOD:432 | name | Cholesterol | def | "Cholesterol ester." [RESID:AA0309, FindMod:CHOL, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=432] | xref | record_id "432" | xref | delta_mono_mass "368.344302" | xref | delta_avge_mass "368.6383" | xref | delta_composition "H(44) C(27)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 20:00:10" | xref | date_time_modified "2006-10-16 16:36:21" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:433] === UNIMOD:433 Didehydroretinylidene |
null .Term [UNIMOD:433] [cols="2*"] |
| id | UNIMOD:433 | name | Didehydroretinylidene | def | "3,4-didehydroretinylidene." [RESID:AA0312, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=433] | xref | record_id "433" | xref | delta_mono_mass "264.187801" | xref | delta_avge_mass "264.4046" | xref | delta_composition "H(24) C(20)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 20:05:19" | xref | date_time_modified "2006-10-16 15:46:50" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:434] === UNIMOD:434 CHDH |
null .Term [UNIMOD:434] [cols="2*"] |
| id | UNIMOD:434 | name | CHDH | def | "Cis-14-hydroxy-10,13-dioxo-7-heptadecenoic ester." [RESID:AA0316, FindMod:CHDH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=434] | xref | record_id "434" | xref | delta_mono_mass "294.183109" | xref | delta_avge_mass "294.3859" | xref | delta_composition "H(26) C(17) O(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 20:08:49" | xref | date_time_modified "2006-10-16 15:49:28" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:435] === UNIMOD:435 Methylpyrroline |
null .Term [UNIMOD:435] [cols="2*"] |
| id | UNIMOD:435 | name | Methylpyrroline | def | "4-methyl-delta-1-pyrroline-5-carboxyl." [RESID:AA0321, FindMod:PYRK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=435] | xref | record_id "435" | xref | delta_mono_mass "109.052764" | xref | delta_avge_mass "109.1259" | xref | delta_composition "H(7) C(6) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 20:21:00" | xref | date_time_modified "2006-10-16 13:37:33" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:436] === UNIMOD:436 Hydroxyheme |
null .Term [UNIMOD:436] [cols="2*"] |
| id | UNIMOD:436 | name | Hydroxyheme | def | "Hydroxyheme." [RESID:AA0324, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=436] | xref | record_id "436" | xref | delta_mono_mass "614.161645" | xref | delta_avge_mass "614.4714" | xref | delta_composition "H(30) C(34) N(4) O(4) Fe" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 20:29:16" | xref | date_time_modified "2006-10-16 17:10:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:437] === UNIMOD:437 MicrocinC7 |
null .Term [UNIMOD:437] [cols="2*"] |
| id | UNIMOD:437 | name | MicrocinC7 | def | "(3-aminopropyl)(L-aspartyl-1-amino)phosphoryl-5-adenosine." [RESID:AA0328, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=437] | xref | record_id "437" | xref | delta_mono_mass "386.110369" | xref | delta_avge_mass "386.3003" | xref | delta_composition "H(19) C(13) N(6) O(6) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 20:36:37" | xref | date_time_modified "2006-10-16 16:40:21" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:438] === UNIMOD:438 Cyano |
null .Term [UNIMOD:438] [cols="2*"] |
| id | UNIMOD:438 | name | Cyano | def | "Cyano." [RESID:AA0333, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=438] | xref | record_id "438" | xref | delta_mono_mass "24.995249" | xref | delta_avge_mass "25.0095" | xref | delta_composition "H(-1) C N" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 20:42:40" | xref | date_time_modified "2006-10-14 19:43:48" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:439] === UNIMOD:439 Diironsubcluster |
null .Term [UNIMOD:439] [cols="2*"] |
| id | UNIMOD:439 | name | Diironsubcluster | def | "Hydrogenase diiron subcluster." [RESID:AA0334, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=439] | xref | record_id "439" | xref | delta_mono_mass "342.786916" | xref | delta_avge_mass "342.876" | xref | delta_composition "H(-1) C(5) N(2) O(5) S(2) Fe(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 20:46:03" | xref | date_time_modified "2006-10-16 16:01:22" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:440] === UNIMOD:440 Amidino |
null .Term [UNIMOD:440] [cols="2*"] |
| id | UNIMOD:440 | name | Amidino | def | "Amidino." [RESID:AA0335, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=440] | xref | record_id "440" | xref | delta_mono_mass "42.021798" | xref | delta_avge_mass "42.04" | xref | delta_composition "H(2) C N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 20:49:10" | xref | date_time_modified "2006-10-15 19:58:03" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:442] === UNIMOD:442 FMN |
null .Term [UNIMOD:442] [cols="2*"] |
| id | UNIMOD:442 | name | FMN | def | "O3-(riboflavin phosphoryl)." [RESID:AA0350, RESID:AA0349, FindMod:FMN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=442] | xref | record_id "442" | xref | delta_mono_mass "438.094051" | xref | delta_avge_mass "438.3285" | xref | delta_composition "H(19) C(17) N(4) O(8) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 21:11:32" | xref | date_time_modified "2006-10-16 16:47:27" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:443] === UNIMOD:443 FMNC |
null .Term [UNIMOD:443] [cols="2*"] |
| id | UNIMOD:443 | name | FMNC | def | "S-(4a-FMN)." [RESID:AA0351, FindMod:FMNC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=443] | xref | record_id "443" | xref | delta_mono_mass "456.104615" | xref | delta_avge_mass "456.3438" | xref | delta_composition "H(21) C(17) N(4) O(9) P" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 21:21:47" | xref | date_time_modified "2006-10-16 16:58:10" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:444] === UNIMOD:444 CuSMo |
null .Term [UNIMOD:444] [cols="2*"] |
| id | UNIMOD:444 | name | CuSMo | def | "Copper sulfido molybdopterin cytosine dinuncleotide." [RESID:AA0355, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=444] | xref | record_id "444" | xref | delta_mono_mass "922.834855" | xref | delta_avge_mass "922.067" | xref | delta_composition "H(24) C(19) N(8) O(15) P(2) S(3) Cu Mo" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 21:34:38" | xref | date_time_modified "2006-10-16 17:20:14" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:445] === UNIMOD:445 Hydroxytrimethyl |
null .Term [UNIMOD:445] [cols="2*"] |
| id | UNIMOD:445 | name | Hydroxytrimethyl | def | "5-hydroxy-N6,N6,N6-trimethyl." [RESID:AA0359, FindMod:TRIMETK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=445] | xref | record_id "445" | xref | delta_mono_mass "59.04969" | xref | delta_avge_mass "59.0871" | xref | delta_composition "H(7) C(3) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 21:40:08" | xref | date_time_modified "2006-10-16 10:28:02" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:447] === UNIMOD:447 Deoxy |
null .Term [UNIMOD:447] [cols="2*"] |
| id | UNIMOD:447 | name | Deoxy | def | "Reduction." [RESID:AA0191, PMID:14235557, RESID:AA0373, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=447] | synonym | "Serine to Alanine Threonine to a-aminobutyrate" [] | xref | record_id "447" | xref | delta_mono_mass "-15.994915" | xref | delta_avge_mass "-15.9994" | xref | delta_composition "O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 22:00:35" | xref | date_time_modified "2006-10-13 17:16:30" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "Beta elimination of O-glycosylation under alkaline conditions followed by reduction" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_3_misc_notes "Beta elimination of O-glycosylation under alkaline conditions followed by reduction" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:448] === UNIMOD:448 Microcin |
null .Term [UNIMOD:448] [cols="2*"] |
| id | UNIMOD:448 | name | Microcin | def | "Microcin E492 siderophore ester from serine." [RESID:AA0374, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=448] | xref | record_id "448" | xref | delta_mono_mass "831.197041" | xref | delta_avge_mass "831.6871" | xref | delta_composition "H(37) C(36) N(3) O(20)" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 22:04:46" | xref | date_time_modified "2006-10-16 17:18:24" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:449] === UNIMOD:449 Decanoyl |
null .Term [UNIMOD:449] [cols="2*"] |
| id | UNIMOD:449 | name | Decanoyl | def | "Lipid." [RESID:AA0387, RESID:AA0385, FindMod:DECA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=449] | xref | record_id "449" | xref | delta_mono_mass "154.135765" | xref | delta_avge_mass "154.2493" | xref | delta_composition "H(18) C(10) O" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2005-10-15 22:14:11" | xref | date_time_modified "2006-10-16 14:04:24" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:450] === UNIMOD:450 Glu |
null .Term [UNIMOD:450] [cols="2*"] |
| id | UNIMOD:450 | name | Glu | def | "Monoglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=450] | xref | record_id "450" | xref | delta_mono_mass "129.042593" | xref | delta_avge_mass "129.114" | xref | delta_composition "H(7) C(5) N O(3)" | xref | username_of_poster "vcavett" | xref | group_of_poster "users" | xref | date_time_posted "2005-10-18 15:07:18" | xref | date_time_modified "2006-10-17 13:48:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:451] === UNIMOD:451 GluGlu |
null .Term [UNIMOD:451] [cols="2*"] |
| id | UNIMOD:451 | name | GluGlu | def | "Diglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=451] | xref | record_id "451" | xref | delta_mono_mass "258.085186" | xref | delta_avge_mass "258.228" | xref | delta_composition "H(14) C(10) N(2) O(6)" | xref | username_of_poster "vcavett" | xref | group_of_poster "users" | xref | date_time_posted "2005-10-18 15:17:59" | xref | date_time_modified "2006-10-17 13:49:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:452] === UNIMOD:452 GluGluGlu |
null .Term [UNIMOD:452] [cols="2*"] |
| id | UNIMOD:452 | name | GluGluGlu | def | "Triglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=452] | xref | record_id "452" | xref | delta_mono_mass "387.127779" | xref | delta_avge_mass "387.3419" | xref | delta_composition "H(21) C(15) N(3) O(9)" | xref | username_of_poster "vcavett" | xref | group_of_poster "users" | xref | date_time_posted "2005-10-18 15:21:01" | xref | date_time_modified "2006-10-17 14:11:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:453] === UNIMOD:453 GluGluGluGlu |
null .Term [UNIMOD:453] [cols="2*"] |
| id | UNIMOD:453 | name | GluGluGluGlu | def | "Tetraglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=453] | xref | record_id "453" | xref | delta_mono_mass "516.170373" | xref | delta_avge_mass "516.4559" | xref | delta_composition "H(28) C(20) N(4) O(12)" | xref | username_of_poster "vcavett" | xref | group_of_poster "users" | xref | date_time_posted "2005-10-18 15:22:24" | xref | date_time_modified "2006-10-17 14:16:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Protein C-term" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:454] === UNIMOD:454 HexN |
null .Term [UNIMOD:454] [cols="2*"] |
| id | UNIMOD:454 | name | HexN | def | "Hexosamine." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=454] | synonym | "Glucosamine Galactosamine" [] | xref | record_id "454" | xref | delta_mono_mass "161.068808" | xref | delta_avge_mass "161.1558" | xref | delta_composition "HexN" | xref | username_of_poster "xyuan" | xref | group_of_poster "users" | xref | date_time_posted "2005-11-08 18:58:20" | xref | date_time_modified "2015-05-01 16:57:37" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Synth. pep. protect. gp." | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_162_mono_mass "161.068808" | xref | spec_2_neutral_loss_162_avge_mass "161.1558" | xref | spec_2_neutral_loss_162_flag "false" | xref | spec_2_neutral_loss_162_composition "HexN" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "O-linked glycosylation" | xref | spec_3_neutral_loss_0_mono_mass "0" | xref | spec_3_neutral_loss_0_avge_mass "0" | xref | spec_3_neutral_loss_0_flag "false" | xref | spec_3_neutral_loss_0_composition "0" | xref | spec_3_neutral_loss_162_mono_mass "161.068808" | xref | spec_3_neutral_loss_162_avge_mass "161.1558" | xref | spec_3_neutral_loss_162_flag "false" | xref | spec_3_neutral_loss_162_composition "HexN" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "S" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "O-linked glycosylation" | xref | spec_3_neutral_loss_0_mono_mass "0" | xref | spec_3_neutral_loss_0_avge_mass "0" | xref | spec_3_neutral_loss_0_flag "false" | xref | spec_3_neutral_loss_0_composition "0" | xref | spec_3_neutral_loss_162_mono_mass "161.068808" | xref | spec_3_neutral_loss_162_avge_mass "161.1558" | xref | spec_3_neutral_loss_162_flag "false" | xref | spec_3_neutral_loss_162_composition "HexN" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "W" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Other glycosylation" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:455] === UNIMOD:455 X154 |
null .Term [UNIMOD:455] [cols="2*"] |
| id | UNIMOD:455 | name | X154 | def | "Free monolink of DMP crosslinker." [URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011314_ImidoesterCrsLnk_DMA_DMP_DMS_DTBP_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=455] | synonym | "Dimethyl pimelimidate" [] | xref | record_id "455" | xref | delta_mono_mass "154.110613" | xref | delta_avge_mass "154.2096" | xref | delta_composition "H(14) C(8) N(2) O" | xref | username_of_poster "mariana" | xref | group_of_poster "users" | xref | date_time_posted "2005-11-08 20:09:24" | xref | date_time_modified "2017-08-18 10:27:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:457] === UNIMOD:457 NDA |
null .Term [UNIMOD:457] [cols="2*"] |
| id | UNIMOD:457 | name | NDA | def | "Naphthalene-2,3-dicarboxaldehyde." [PMID:2081203, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=457] | comment | Fluorescent derivative. | xref | record_id "457" | xref | delta_mono_mass "175.042199" | xref | delta_avge_mass "175.1855" | xref | delta_composition "H(5) C(13) N" | xref | username_of_poster "Dekker" | xref | group_of_poster "users" | xref | date_time_posted "2005-11-11 11:03:32" | xref | date_time_modified "2006-10-17 13:41:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:464] === UNIMOD:464 SPITC:13C(6) |
null .Term [UNIMOD:464] [cols="2*"] |
| id | UNIMOD:464 | name | SPITC:13C(6) | def | "4-sulfophenyl isothiocyanate (Heavy C13)." [PMID:16526082, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=464] | synonym | "N-terminal / lysine sulfonation" [] | xref | record_id "464" | xref | delta_mono_mass "220.991213" | xref | delta_avge_mass "221.2054" | xref | delta_composition "H(5) C 13C(6) N O(3) S(2)" | xref | username_of_poster "apanchaud" | xref | group_of_poster "users" | xref | date_time_posted "2005-12-19 08:37:57" | xref | date_time_modified "2006-10-16 15:25:36" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:472] === UNIMOD:472 AEC-MAEC |
null .Term [UNIMOD:472] [cols="2*"] |
| id | UNIMOD:472 | name | AEC-MAEC | def | "Aminoethylcysteine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=472] | comment | Modification procedure used for phosphopeptide mapping. | synonym | "beta-methylaminoethylcysteine" [] | xref | record_id "472" | xref | delta_mono_mass "59.019355" | xref | delta_avge_mass "59.1334" | xref | delta_composition "H(5) C(2) N O(-1) S" | xref | username_of_poster "mpcusack" | xref | group_of_poster "users" | xref | date_time_posted "2006-01-20 00:46:08" | xref | date_time_modified "2007-09-26 22:43:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "pS gives aminoethylcysteine" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "pT gives beta-methylaminoethylcysteine" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:476] === UNIMOD:476 TMAB |
null .Term [UNIMOD:476] [cols="2*"] |
| id | UNIMOD:476 | name | TMAB | def | "4-trimethyllammoniumbutyryl-." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=476] | xref | record_id "476" | xref | delta_mono_mass "128.107539" | xref | delta_avge_mass "128.1922" | xref | delta_composition "H(14) C(7) N O" | xref | username_of_poster "xwei" | xref | group_of_poster "users" | xref | date_time_posted "2006-02-15 03:10:16" | xref | date_time_modified "2006-10-17 12:08:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_neutral_loss_60_mono_mass "59.073499" | xref | spec_1_neutral_loss_60_avge_mass "59.1103" | xref | spec_1_neutral_loss_60_flag "false" | xref | spec_1_neutral_loss_60_composition "H(9) C(3) N" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_neutral_loss_60_mono_mass "59.073499" | xref | spec_2_neutral_loss_60_avge_mass "59.1103" | xref | spec_2_neutral_loss_60_flag "false" | xref | spec_2_neutral_loss_60_composition "H(9) C(3) N" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:477] === UNIMOD:477 TMAB:2H(9) |
null .Term [UNIMOD:477] [cols="2*"] |
| id | UNIMOD:477 | name | TMAB:2H(9) | def | "D9-4-trimethyllammoniumbutyryl-." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=477] | xref | record_id "477" | xref | delta_mono_mass "137.16403" | xref | delta_avge_mass "137.2476" | xref | delta_composition "H(5) 2H(9) C(7) N O" | xref | username_of_poster "xwei" | xref | group_of_poster "users" | xref | date_time_posted "2006-02-15 18:36:06" | xref | date_time_modified "2006-10-17 12:08:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_neutral_loss_69_mono_mass "68.12999" | xref | spec_1_neutral_loss_69_avge_mass "68.1657" | xref | spec_1_neutral_loss_69_flag "false" | xref | spec_1_neutral_loss_69_composition "2H(9) C(3) N" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_neutral_loss_69_mono_mass "68.12999" | xref | spec_2_neutral_loss_69_avge_mass "68.1657" | xref | spec_2_neutral_loss_69_flag "false" | xref | spec_2_neutral_loss_69_composition "2H(9) C(3) N" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:478] === UNIMOD:478 FTC |
null .Term [UNIMOD:478] [cols="2*"] |
| id | UNIMOD:478 | name | FTC | def | "Fluorescein-5-thiosemicarbazide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=478] | xref | record_id "478" | xref | delta_mono_mass "421.073241" | xref | delta_avge_mass "421.4259" | xref | delta_composition "H(15) C(21) N(3) O(5) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2006-02-20 11:15:03" | xref | date_time_modified "2006-10-16 16:45:27" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "P" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "R" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:481] === UNIMOD:481 Label:2H(4) |
null .Term [UNIMOD:481] [cols="2*"] |
| id | UNIMOD:481 | name | Label:2H(4) | def | "4,4,5,5-D4 Lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=481] | comment | For SILAC experiments. | synonym | "Alanine-2,3,3,3-d4" [] | xref | record_id "481" | xref | delta_mono_mass "4.025107" | xref | delta_avge_mass "4.0246" | xref | delta_composition "H(-4) 2H(4)" | xref | username_of_poster "yunwah" | xref | group_of_poster "users" | xref | date_time_posted "2006-02-20 11:44:19" | xref | date_time_modified "2019-01-10 15:45:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "F" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Cambridge Labs DLM-451" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "A" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "485845 Aldrich" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "U" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:488] === UNIMOD:488 DHP |
null .Term [UNIMOD:488] [cols="2*"] |
| id | UNIMOD:488 | name | DHP | def | "Dehydropyrrolizidine alkaloid (dehydroretronecine) on cysteines." [PMID:16222722, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=488] | synonym | "Dehydroretronecine" [] | xref | record_id "488" | xref | delta_mono_mass "118.065674" | xref | delta_avge_mass "118.1558" | xref | delta_composition "H(8) C(8) N" | xref | username_of_poster "rowanrainbow" | xref | group_of_poster "users" | xref | date_time_posted "2006-03-07 08:40:13" | xref | date_time_modified "2006-10-17 12:07:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:490] === UNIMOD:490 Hep |
null .Term [UNIMOD:490] [cols="2*"] |
| id | UNIMOD:490 | name | Hep | def | "Heptose." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=490] | xref | record_id "490" | xref | delta_mono_mass "192.063388" | xref | delta_avge_mass "192.1666" | xref | delta_composition "Hep" | xref | username_of_poster "anikolakakis" | xref | group_of_poster "users" | xref | date_time_posted "2006-03-24 15:59:43" | xref | date_time_modified "2015-05-05 15:58:34" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_193_mono_mass "192.063388" | xref | spec_2_neutral_loss_193_avge_mass "192.1666" | xref | spec_2_neutral_loss_193_flag "false" | xref | spec_2_neutral_loss_193_composition "Hep" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Q" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Other glycosylation" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "R" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "N-linked glycosylation" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "O-linked glycosylation" | xref | spec_5_neutral_loss_193_mono_mass "192.063388" | xref | spec_5_neutral_loss_193_avge_mass "192.1666" | xref | spec_5_neutral_loss_193_flag "false" | xref | spec_5_neutral_loss_193_composition "Hep" | xref | spec_5_neutral_loss_0_mono_mass "0" | xref | spec_5_neutral_loss_0_avge_mass "0" | xref | spec_5_neutral_loss_0_flag "false" | xref | spec_5_neutral_loss_0_composition "0" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "O-linked glycosylation" | xref | spec_5_neutral_loss_193_mono_mass "192.063388" | xref | spec_5_neutral_loss_193_avge_mass "192.1666" | xref | spec_5_neutral_loss_193_flag "false" | xref | spec_5_neutral_loss_193_composition "Hep" | xref | spec_5_neutral_loss_0_mono_mass "0" | xref | spec_5_neutral_loss_0_avge_mass "0" | xref | spec_5_neutral_loss_0_flag "false" | xref | spec_5_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:493] === UNIMOD:493 BADGE |
null .Term [UNIMOD:493] [cols="2*"] |
| id | UNIMOD:493 | name | BADGE | def | "Bisphenol A diglycidyl ether derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=493] | comment | Found in canned food products. | xref | record_id "493" | xref | delta_mono_mass "340.167459" | xref | delta_avge_mass "340.4129" | xref | delta_composition "H(24) C(21) O(4)" | xref | username_of_poster "TNO" | xref | group_of_poster "users" | xref | date_time_posted "2006-03-27 09:30:54" | xref | date_time_modified "2006-10-17 14:09:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Non-standard residue" | xref | spec_1_misc_notes "found in canned food products" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:494] === UNIMOD:494 CyDye-Cy3 |
null .Term [UNIMOD:494] [cols="2*"] |
| id | UNIMOD:494 | name | CyDye-Cy3 | def | "Cy3 CyDye DIGE Fluor saturation dye." [PMID:12872219, URL:https\://www.gelifesciences.com/gehcls_images/GELS/Related Content/Files/1314735988470/litdoc28953107AD_20110831002141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=494] | synonym | "Formula needs confirmation" [] | xref | record_id "494" | xref | delta_mono_mass "672.298156" | xref | delta_avge_mass "672.8335" | xref | delta_composition "H(44) C(37) N(4) O(6) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2006-03-27 11:17:51" | xref | date_time_modified "2012-09-15 00:20:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:495] === UNIMOD:495 CyDye-Cy5 |
null .Term [UNIMOD:495] [cols="2*"] |
| id | UNIMOD:495 | name | CyDye-Cy5 | def | "Cy5 CyDye DIGE Fluor saturation dye." [PMID:12872219, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=495] | xref | record_id "495" | xref | delta_mono_mass "684.298156" | xref | delta_avge_mass "684.8442" | xref | delta_composition "H(44) C(38) N(4) O(6) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2006-03-27 11:53:04" | xref | date_time_modified "2006-10-17 14:18:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:498] === UNIMOD:498 BHTOH |
null .Term [UNIMOD:498] [cols="2*"] |
| id | UNIMOD:498 | name | BHTOH | def | "Michael addition of t-butyl hydroxylated BHT (BHTOH) to C, H or K." [PMID:16533022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=498] | comment | BHTOH is formed upon metabolism of BHT with P450 enzymes. The BHTOH is further metabolized to its quinone methide (electrophile) which reacts with -SH and -NH2 groups. | synonym | "t-butyl hydroxylated BHT" [] | xref | record_id "498" | xref | delta_mono_mass "234.16198" | xref | delta_avge_mass "234.334" | xref | delta_composition "H(22) C(15) O(2)" | xref | username_of_poster "rkupfer" | xref | group_of_poster "users" | xref | date_time_posted "2006-04-10 19:27:51" | xref | date_time_modified "2006-10-17 13:42:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "primary adduct" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:499] === UNIMOD:499 IGBP:13C(2) |
null .Term [UNIMOD:499] [cols="2*"] |
| id | UNIMOD:499 | name | IGBP:13C(2) | def | "Heavy IDBEST tag for quantitation." [URL:http\://www.targetdiscovery.com/index.php?topic=prod.idbe, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=499] | xref | record_id "499" | xref | delta_mono_mass "298.022748" | xref | delta_avge_mass "299.1331" | xref | delta_composition "H(13) C(10) 13C(2) N(2) O(2) Br" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2006-04-14 18:44:41" | xref | date_time_modified "2006-10-19 10:48:25" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:500] === UNIMOD:500 Nmethylmaleimide+water |
null .Term [UNIMOD:500] [cols="2*"] |
| id | UNIMOD:500 | name | Nmethylmaleimide+water | def | "Nmethylmaleimidehydrolysis." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=500] | xref | record_id "500" | xref | delta_mono_mass "129.042593" | xref | delta_avge_mass "129.114" | xref | delta_composition "H(7) C(5) N O(3)" | xref | username_of_poster "whaskins" | xref | group_of_poster "users" | xref | date_time_posted "2006-04-14 22:58:34" | xref | date_time_modified "2006-10-17 12:12:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:501] === UNIMOD:501 PyMIC |
null .Term [UNIMOD:501] [cols="2*"] |
| id | UNIMOD:501 | name | PyMIC | def | "3-methyl-2-pyridyl isocyanate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=501] | xref | record_id "501" | xref | delta_mono_mass "134.048013" | xref | delta_avge_mass "134.1353" | xref | delta_composition "H(6) C(7) N(2) O" | xref | username_of_poster "TING" | xref | group_of_poster "users" | xref | date_time_posted "2006-04-18 20:46:17" | xref | date_time_modified "2006-10-17 12:19:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:503] === UNIMOD:503 LG-lactam-K |
null .Term [UNIMOD:503] [cols="2*"] |
| id | UNIMOD:503 | name | LG-lactam-K | def | "Levuglandinyl - lysine lactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=503] | xref | record_id "503" | xref | delta_mono_mass "332.19876" | xref | delta_avge_mass "332.4339" | xref | delta_composition "H(28) C(20) O(4)" | xref | username_of_poster "alexparf" | xref | group_of_poster "users" | xref | date_time_posted "2006-04-27 17:56:39" | xref | date_time_modified "2006-11-14 12:04:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:504] === UNIMOD:504 LG-Hlactam-K |
null .Term [UNIMOD:504] [cols="2*"] |
| id | UNIMOD:504 | name | LG-Hlactam-K | def | "Levuglandinyl - lysine hydroxylactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=504] | xref | record_id "504" | xref | delta_mono_mass "348.193674" | xref | delta_avge_mass "348.4333" | xref | delta_composition "H(28) C(20) O(5)" | xref | username_of_poster "alexparf" | xref | group_of_poster "users" | xref | date_time_posted "2006-04-27 18:02:17" | xref | date_time_modified "2006-11-14 12:04:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:505] === UNIMOD:505 LG-lactam-R |
null .Term [UNIMOD:505] [cols="2*"] |
| id | UNIMOD:505 | name | LG-lactam-R | def | "Levuglandinyl - arginine lactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=505] | xref | record_id "505" | xref | delta_mono_mass "290.176961" | xref | delta_avge_mass "290.3939" | xref | delta_composition "H(26) C(19) N(-2) O(4)" | xref | username_of_poster "alexparf" | xref | group_of_poster "users" | xref | date_time_posted "2006-04-27 18:05:11" | xref | date_time_modified "2006-10-17 14:08:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:506] === UNIMOD:506 LG-Hlactam-R |
null .Term [UNIMOD:506] [cols="2*"] |
| id | UNIMOD:506 | name | LG-Hlactam-R | def | "Levuglandinyl - arginine hydroxylactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=506] | xref | record_id "506" | xref | delta_mono_mass "306.171876" | xref | delta_avge_mass "306.3933" | xref | delta_composition "H(26) C(19) N(-2) O(5)" | xref | username_of_poster "alexparf" | xref | group_of_poster "users" | xref | date_time_posted "2006-04-27 18:08:11" | xref | date_time_modified "2006-10-17 14:08:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:510] === UNIMOD:510 Dimethyl:2H(4)13C(2) |
null .Term [UNIMOD:510] [cols="2*"] |
| id | UNIMOD:510 | name | Dimethyl:2H(4)13C(2) | def | "DiMethyl-C13HD2." [PMID:16335955, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=510] | xref | record_id "510" | xref | delta_mono_mass "34.063117" | xref | delta_avge_mass "34.0631" | xref | delta_composition "2H(4) 13C(2)" | xref | username_of_poster "oded" | xref | group_of_poster "users" | xref | date_time_posted "2006-05-08 22:03:41" | xref | date_time_modified "2014-11-16 07:37:20" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "R" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N-term" | xref | spec_4_position "Protein N-term" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "When dimethyl labelling is pre-digest" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:512] === UNIMOD:512 Hex(2) |
null .Term [UNIMOD:512] [cols="2*"] |
| id | UNIMOD:512 | name | Hex(2) | def | "Lactosylation." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=512] | comment | Lactosylation of bovine Beta-Lactoglobulin. | synonym | "lac" [] | xref | record_id "512" | xref | delta_mono_mass "324.105647" | xref | delta_avge_mass "324.2812" | xref | delta_composition "Hex(2)" | xref | username_of_poster "molle" | xref | group_of_poster "users" | xref | date_time_posted "2006-05-11 13:21:17" | xref | date_time_modified "2017-11-23 12:59:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | xref | spec_1_misc_notes "Maillard reaction (first event)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other glycosylation" | xref | spec_2_misc_notes "Maillard reaction (first event)" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "S" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "O-linked glycosylation" | xref | spec_3_neutral_loss_0_mono_mass "0" | xref | spec_3_neutral_loss_0_avge_mass "0" | xref | spec_3_neutral_loss_0_flag "false" | xref | spec_3_neutral_loss_0_composition "0" | xref | spec_3_neutral_loss_325_mono_mass "324.105647" | xref | spec_3_neutral_loss_325_avge_mass "324.2812" | xref | spec_3_neutral_loss_325_flag "false" | xref | spec_3_neutral_loss_325_composition "Hex(2)" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "O-linked glycosylation" | xref | spec_3_neutral_loss_0_mono_mass "0" | xref | spec_3_neutral_loss_0_avge_mass "0" | xref | spec_3_neutral_loss_0_flag "false" | xref | spec_3_neutral_loss_0_composition "0" | xref | spec_3_neutral_loss_325_mono_mass "324.105647" | xref | spec_3_neutral_loss_325_avge_mass "324.2812" | xref | spec_3_neutral_loss_325_flag "false" | xref | spec_3_neutral_loss_325_composition "Hex(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:513] === UNIMOD:513 C8-QAT |
null .Term [UNIMOD:513] [cols="2*"] |
| id | UNIMOD:513 | name | C8-QAT | def | "[3-(2,5)-Dioxopyrrolidin-1-yloxycarbonyl)-propyl]dimethyloctylammonium." [PMID:16771548, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=513] | xref | record_id "513" | xref | delta_mono_mass "227.224915" | xref | delta_avge_mass "227.3862" | xref | delta_composition "H(29) C(14) N O" | xref | username_of_poster "amadian" | xref | group_of_poster "users" | xref | date_time_posted "2006-05-13 20:55:20" | xref | date_time_modified "2006-12-03 19:43:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:514] === UNIMOD:514 PropylNAGthiazoline |
null .Term [UNIMOD:514] [cols="2*"] |
| id | UNIMOD:514 | name | PropylNAGthiazoline | def | "Propyl-1,2-dideoxy-2\'-methyl-alpha-D-glucopyranoso-[2,1-d]-Delta2\'-thiazoline." [PMID:15795231, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=514] | comment | In a recent publication (see reference), we have shown that family 84 glycoside hydrolases contain a deep pocket beneath the 2-acetamido group of its substrate (N-acetyl-glucosamine). With this strucual feature in mind, we have designed a specific inhibitor that contains a chloride group appended to the end of the propyl chain on a known inhibitor termed propyl-NAG-thiazoline. We have shown kinetically that this molecule is a potent suicide inhibitor of this enzyme famiy and now wish to know the precise residue which is acting as the nucleophile to dispace the choride atom. We have included all residues that are in the vacinity of the chloride atom that could potentially act in a nucleophilic manner. | xref | record_id "514" | xref | delta_mono_mass "232.064354" | xref | delta_avge_mass "232.2768" | xref | delta_composition "H(14) C(9) N O(4) S" | xref | username_of_poster "mmacaule" | xref | group_of_poster "users" | xref | date_time_posted "2006-05-18 18:44:52" | xref | date_time_modified "2015-05-01 13:33:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:515] === UNIMOD:515 FNEM |
null .Term [UNIMOD:515] [cols="2*"] |
| id | UNIMOD:515 | name | FNEM | def | "Fluorescein-5-maleimide." [PMID:9325338, PMID:11665566, URL:http\://probes.invitrogen.com/media/pis/mp00003.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=515] | synonym | "fluorescein-NEM" [] | xref | record_id "515" | xref | delta_mono_mass "427.069202" | xref | delta_avge_mass "427.3625" | xref | delta_composition "H(13) C(24) N O(7)" | xref | username_of_poster "shure" | xref | group_of_poster "users" | xref | date_time_posted "2006-06-08 10:07:56" | xref | date_time_modified "2006-10-17 14:15:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "photosensitive" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:518] === UNIMOD:518 Diethyl |
null .Term [UNIMOD:518] [cols="2*"] |
| id | UNIMOD:518 | name | Diethyl | def | "Diethylation, analogous to Dimethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=518] | xref | record_id "518" | xref | delta_mono_mass "56.0626" | xref | delta_avge_mass "56.1063" | xref | delta_composition "H(8) C(4)" | xref | username_of_poster "PhilipHsu" | xref | group_of_poster "users" | xref | date_time_posted "2006-06-15 07:18:26" | xref | date_time_modified "2006-10-17 12:00:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:519] === UNIMOD:519 BisANS |
null .Term [UNIMOD:519] [cols="2*"] |
| id | UNIMOD:519 | name | BisANS | def | "4,4\'-dianilino-1,1\'-binaphthyl-5,5\'-disulfonic acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=519] | xref | record_id "519" | xref | delta_mono_mass "594.091928" | xref | delta_avge_mass "594.6569" | xref | delta_composition "H(22) C(32) N(2) O(6) S(2)" | xref | username_of_poster "app95d" | xref | group_of_poster "users" | xref | date_time_posted "2006-07-05 23:31:08" | xref | date_time_modified "2012-05-15 20:15:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:520] === UNIMOD:520 Piperidine |
null .Term [UNIMOD:520] [cols="2*"] |
| id | UNIMOD:520 | name | Piperidine | def | "Piperidination." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=520] | xref | record_id "520" | xref | delta_mono_mass "68.0626" | xref | delta_avge_mass "68.117" | xref | delta_composition "H(8) C(5)" | xref | username_of_poster "PhilipHsu" | xref | group_of_poster "users" | xref | date_time_posted "2006-07-20 08:37:21" | xref | date_time_modified "2006-10-17 12:05:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:522] === UNIMOD:522 Maleimide-PEO2-Biotin |
null .Term [UNIMOD:522] [cols="2*"] |
| id | UNIMOD:522 | name | Maleimide-PEO2-Biotin | def | "Maleimide-Biotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031005, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=522] | synonym | "Maleimide-PEG2-Biotin" [] | xref | record_id "522" | xref | delta_mono_mass "525.225719" | xref | delta_avge_mass "525.6183" | xref | delta_composition "H(35) C(23) N(5) O(7) S" | xref | username_of_poster "ericjohansen" | xref | group_of_poster "users" | xref | date_time_posted "2006-08-11 02:49:51" | xref | date_time_modified "2010-12-03 16:13:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:523] === UNIMOD:523 Sulfo-NHS-LC-LC-Biotin |
null .Term [UNIMOD:523] [cols="2*"] |
| id | UNIMOD:523 | name | Sulfo-NHS-LC-LC-Biotin | def | "Biot_LC_LC." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=8D38BA83-EFDC-421A-853F-E96EBA380612, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=523] | synonym | "Sulfo-NHS-LC-LC-Biotin" [] | xref | record_id "523" | xref | delta_mono_mass "452.245726" | xref | delta_avge_mass "452.6106" | xref | delta_composition "H(36) C(22) N(4) O(4) S" | xref | username_of_poster "unimod" | xref | group_of_poster "admin" | xref | date_time_posted "2006-08-31 18:01:50" | xref | date_time_modified "2010-12-03 16:11:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:525] === UNIMOD:525 CLIP_TRAQ_2 |
null .Term [UNIMOD:525] [cols="2*"] |
| id | UNIMOD:525 | name | CLIP_TRAQ_2 | def | "CLIP_TRAQ_2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=525] | comment | CLIP-TRAQ-2 H(17) C(10) C13 N(3) O(4) is an in-house made compound that reacts with primary amines through a N-hydroxysuccinimide group leading to a 141.0983 Da mass shift (monoisotopic) in MS mode. The reporter ion in MS/MS mode can either be 113 or 114 m/z depending on the position of isotopic C13 in the molecule. (Fahlman, R. and Overall, C.M. ; in preparation). | synonym | "CLIP_TRAQ_double" [] | xref | record_id "525" | xref | delta_mono_mass "141.098318" | xref | delta_avge_mass "141.1756" | xref | delta_composition "H(12) C(6) 13C N(2) O" | xref | username_of_poster "overalllab" | xref | group_of_poster "users" | xref | date_time_posted "2006-09-15 02:25:46" | xref | date_time_modified "2006-10-17 18:04:46" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Side reaction, low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:526] === UNIMOD:526 Dethiomethyl |
null .Term [UNIMOD:526] [cols="2*"] |
| id | UNIMOD:526 | name | Dethiomethyl | def | "Prompt loss of side chain from oxidised Met." [PMID:9004526, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=526] | comment | More commonly seen as a neutral loss. | xref | record_id "526" | xref | delta_mono_mass "-48.003371" | xref | delta_avge_mass "-48.1075" | xref | delta_composition "H(-4) C(-1) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-10-13 15:14:55" | xref | date_time_modified "2006-10-13 17:02:27" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:528] === UNIMOD:528 Methyl+Deamidated |
null .Term [UNIMOD:528] [cols="2*"] |
| id | UNIMOD:528 | name | Methyl+Deamidated | def | "Deamidation followed by a methylation." [FindMod:DEAME, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=528] | synonym | "Glutamate methyl ester" [] | xref | record_id "528" | xref | delta_mono_mass "14.999666" | xref | delta_avge_mass "15.0113" | xref | delta_composition "H C N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-10-14 10:39:08" | xref | date_time_modified "2007-02-04 12:25:42" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:529] === UNIMOD:529 Delta:H(5)C(2) |
null .Term [UNIMOD:529] [cols="2*"] |
| id | UNIMOD:529 | name | Delta:H(5)C(2) | def | "Dimethylation of proline residue." [FindMod:DIMETP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=529] | xref | record_id "529" | xref | delta_mono_mass "29.039125" | xref | delta_avge_mass "29.0611" | xref | delta_composition "H(5) C(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-10-15 18:02:34" | xref | date_time_modified "2006-10-15 18:03:16" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:530] === UNIMOD:530 Cation:K |
null .Term [UNIMOD:530] [cols="2*"] |
| id | UNIMOD:530 | name | Cation:K | def | "Replacement of proton by potassium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=530] | xref | record_id "530" | xref | delta_mono_mass "37.955882" | xref | delta_avge_mass "38.0904" | xref | delta_composition "H(-1) K" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-10-15 18:29:43" | xref | date_time_modified "2006-10-18 11:17:39" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:531] === UNIMOD:531 Cation:Cu[I] |
null .Term [UNIMOD:531] [cols="2*"] |
| id | UNIMOD:531 | name | Cation:Cu[I] | def | "Replacement of proton by copper." [URL:http\://www.uniprot.org/uniprot/P07509, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=531] | xref | record_id "531" | xref | delta_mono_mass "61.921774" | xref | delta_avge_mass "62.5381" | xref | delta_composition "H(-1) Cu" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-10-16 10:29:12" | xref | date_time_modified "2015-03-19 09:33:03" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "H" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:532] === UNIMOD:532 iTRAQ4plex114 |
null .Term [UNIMOD:532] [cols="2*"] |
| id | UNIMOD:532 | name | iTRAQ4plex114 | def | "Accurate mass for 114." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=532] | comment | Different channels have the same nominal mass but slightly different exact masses. | synonym | "Applied Biosystems iTRAQ™ multiplexed quantitation chemistry" [] | xref | record_id "532" | xref | delta_mono_mass "144.105918" | xref | delta_avge_mass "144.168" | xref | delta_composition "H(12) C(5) 13C(2) N(2) 18O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-10-16 13:46:49" | xref | date_time_modified "2017-11-09 09:36:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "C" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "side reaction" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:533] === UNIMOD:533 iTRAQ4plex115 |
null .Term [UNIMOD:533] [cols="2*"] |
| id | UNIMOD:533 | name | iTRAQ4plex115 | def | "Accurate mass for 115." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=533] | comment | Different channels have the same nominal mass but slightly different exact masses. | synonym | "Applied Biosystems iTRAQ™ multiplexed quantitation chemistry" [] | xref | record_id "533" | xref | delta_mono_mass "144.099599" | xref | delta_avge_mass "144.1688" | xref | delta_composition "H(12) C(6) 13C N 15N 18O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-10-16 13:48:16" | xref | date_time_modified "2017-11-09 09:34:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "C" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "side reaction" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:534] === UNIMOD:534 Dibromo |
null .Term [UNIMOD:534] [cols="2*"] |
| id | UNIMOD:534 | name | Dibromo | def | "Dibromo." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=534] | xref | record_id "534" | xref | delta_mono_mass "155.821022" | xref | delta_avge_mass "157.7921" | xref | delta_composition "H(-2) Br(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-10-16 14:06:38" | xref | date_time_modified "2006-10-16 14:06:38" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:535] === UNIMOD:535 LRGG |
null .Term [UNIMOD:535] [cols="2*"] |
| id | UNIMOD:535 | name | LRGG | def | "Ubiquitination." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=535] | synonym | "Addition of LRGG" [] | xref | record_id "535" | xref | delta_mono_mass "383.228103" | xref | delta_avge_mass "383.446" | xref | delta_composition "H(29) C(16) N(7) O(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-10-16 16:39:05" | xref | date_time_modified "2014-07-09 16:48:40" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:536] === UNIMOD:536 CLIP_TRAQ_3 |
null .Term [UNIMOD:536] [cols="2*"] |
| id | UNIMOD:536 | name | CLIP_TRAQ_3 | def | "CLIP_TRAQ_3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=536] | comment | CLIP_TRAQ_3 (H(20) C(11) C13 N(3) O(4) is an in-house made compound that reacts with primary amines through a N-hydroxysuccinimide group leading to a 155.1 Da mass shift (monoisotopic) in MS mode. The reporter ion in MS/MS mode can either be 127 or 128 m/z depending on the position of isotopic C13 in the molecule. (Fahlman, R. and Overall, C.M. ; in preparation). | xref | record_id "536" | xref | delta_mono_mass "271.148736" | xref | delta_avge_mass "271.2976" | xref | delta_composition "H(20) C(11) 13C N(3) O(4)" | xref | username_of_poster "overall" | xref | group_of_poster "" | xref | date_time_posted "2006-10-17 18:08:00" | xref | date_time_modified "2006-10-17 18:11:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:537] === UNIMOD:537 CLIP_TRAQ_4 |
null .Term [UNIMOD:537] [cols="2*"] |
| id | UNIMOD:537 | name | CLIP_TRAQ_4 | def | "CLIP_TRAQ_4." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=537] | comment | CLIP_TRAQ_4 is an in-house made compound that reacts with primary amines through a N-hydroxysuccinimide group leading to a 128.1 Da mass shift (monoisotopic) in MS mode. The reporter ion in MS/MS mode can either be 100 or 101 m/z depending on the position of isotopic C13 in the molecule. (Fahlman, R. and Overall, C.M. ; in preparation). | xref | record_id "537" | xref | delta_mono_mass "244.101452" | xref | delta_avge_mass "244.2292" | xref | delta_composition "H(15) C(9) 13C N(2) O(5)" | xref | username_of_poster "overall" | xref | group_of_poster "" | xref | date_time_posted "2006-10-17 18:09:22" | xref | date_time_modified "2006-10-17 18:10:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:538] === UNIMOD:538 Biotin:Cayman-10141 |
null .Term [UNIMOD:538] [cols="2*"] |
| id | UNIMOD:538 | name | Biotin:Cayman-10141 | def | "Was 15dB-biotin." [URL:http\://www.caymanchem.com/pdfs/10141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=538] | synonym | "15-deoxy-delta 12,14-Prostaglandin J2-biotinimide" [] | xref | record_id "538" | xref | delta_mono_mass "626.386577" | xref | delta_avge_mass "626.8927" | xref | delta_composition "H(54) C(35) N(4) O(4) S" | xref | username_of_poster "sevgh" | xref | group_of_poster "" | xref | date_time_posted "2006-10-17 18:13:45" | xref | date_time_modified "2010-12-03 16:08:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:539] === UNIMOD:539 Biotin:Cayman-10013 |
null .Term [UNIMOD:539] [cols="2*"] |
| id | UNIMOD:539 | name | Biotin:Cayman-10013 | def | "Was PGA1-biotin." [URL:http\://www.caymanchem.com/pdfs/10013.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=539] | synonym | "Prostaglandin A1-biotinimide" [] | xref | record_id "539" | xref | delta_mono_mass "660.428442" | xref | delta_avge_mass "660.9504" | xref | delta_composition "H(60) C(36) N(4) O(5) S" | xref | username_of_poster "sevgh" | xref | group_of_poster "" | xref | date_time_posted "2006-10-17 18:24:06" | xref | date_time_modified "2010-12-03 16:07:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:540] === UNIMOD:540 Ala→Ser |
null .Term [UNIMOD:540] [cols="2*"] |
| id | UNIMOD:540 | name | Ala→Ser | def | "Ala→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=540] | xref | record_id "540" | xref | delta_mono_mass "15.994915" | xref | delta_avge_mass "15.9994" | xref | delta_composition "O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:07:30" | xref | date_time_modified "2006-11-09 10:07:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:541] === UNIMOD:541 Ala→Thr |
null .Term [UNIMOD:541] [cols="2*"] |
| id | UNIMOD:541 | name | Ala→Thr | def | "Ala→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=541] | xref | record_id "541" | xref | delta_mono_mass "30.010565" | xref | delta_avge_mass "30.026" | xref | delta_composition "H(2) C O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:13:43" | xref | date_time_modified "2006-11-09 10:13:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:542] === UNIMOD:542 Ala→Asp |
null .Term [UNIMOD:542] [cols="2*"] |
| id | UNIMOD:542 | name | Ala→Asp | def | "Ala→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=542] | xref | record_id "542" | xref | delta_mono_mass "43.989829" | xref | delta_avge_mass "44.0095" | xref | delta_composition "C O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:15:05" | xref | date_time_modified "2006-11-09 10:15:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:543] === UNIMOD:543 Ala→Pro |
null .Term [UNIMOD:543] [cols="2*"] |
| id | UNIMOD:543 | name | Ala→Pro | def | "Ala→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=543] | xref | record_id "543" | xref | delta_mono_mass "26.01565" | xref | delta_avge_mass "26.0373" | xref | delta_composition "H(2) C(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:16:03" | xref | date_time_modified "2006-11-09 10:16:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:544] === UNIMOD:544 Ala→Gly |
null .Term [UNIMOD:544] [cols="2*"] |
| id | UNIMOD:544 | name | Ala→Gly | def | "Ala→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=544] | xref | record_id "544" | xref | delta_mono_mass "-14.01565" | xref | delta_avge_mass "-14.0266" | xref | delta_composition "H(-2) C(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:16:35" | xref | date_time_modified "2006-11-09 10:16:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:545] === UNIMOD:545 Ala→Glu |
null .Term [UNIMOD:545] [cols="2*"] |
| id | UNIMOD:545 | name | Ala→Glu | def | "Ala→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=545] | xref | record_id "545" | xref | delta_mono_mass "58.005479" | xref | delta_avge_mass "58.0361" | xref | delta_composition "H(2) C(2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:19:56" | xref | date_time_modified "2006-11-09 10:19:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:546] === UNIMOD:546 Ala→Val |
null .Term [UNIMOD:546] [cols="2*"] |
| id | UNIMOD:546 | name | Ala→Val | def | "Ala→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=546] | xref | record_id "546" | xref | delta_mono_mass "28.0313" | xref | delta_avge_mass "28.0532" | xref | delta_composition "H(4) C(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:20:15" | xref | date_time_modified "2006-11-09 10:20:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:547] === UNIMOD:547 Cys→Phe |
null .Term [UNIMOD:547] [cols="2*"] |
| id | UNIMOD:547 | name | Cys→Phe | def | "Cys→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=547] | xref | record_id "547" | xref | delta_mono_mass "44.059229" | xref | delta_avge_mass "44.031" | xref | delta_composition "H(4) C(6) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:20:41" | xref | date_time_modified "2006-11-09 10:20:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:548] === UNIMOD:548 Cys→Ser |
null .Term [UNIMOD:548] [cols="2*"] |
| id | UNIMOD:548 | name | Cys→Ser | def | "Cys→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=548] | xref | record_id "548" | xref | delta_mono_mass "-15.977156" | xref | delta_avge_mass "-16.0656" | xref | delta_composition "O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:21:13" | xref | date_time_modified "2006-11-09 10:21:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:549] === UNIMOD:549 Cys→Trp |
null .Term [UNIMOD:549] [cols="2*"] |
| id | UNIMOD:549 | name | Cys→Trp | def | "Cys→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=549] | xref | record_id "549" | xref | delta_mono_mass "83.070128" | xref | delta_avge_mass "83.067" | xref | delta_composition "H(5) C(8) N S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:21:37" | xref | date_time_modified "2006-11-09 10:21:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:550] === UNIMOD:550 Cys→Tyr |
null .Term [UNIMOD:550] [cols="2*"] |
| id | UNIMOD:550 | name | Cys→Tyr | def | "Cys→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=550] | xref | record_id "550" | xref | delta_mono_mass "60.054144" | xref | delta_avge_mass "60.0304" | xref | delta_composition "H(4) C(6) O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:22:04" | xref | date_time_modified "2006-11-09 10:22:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:551] === UNIMOD:551 Cys→Arg |
null .Term [UNIMOD:551] [cols="2*"] |
| id | UNIMOD:551 | name | Cys→Arg | def | "Cys→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=551] | xref | record_id "551" | xref | delta_mono_mass "53.091927" | xref | delta_avge_mass "53.0428" | xref | delta_composition "H(7) C(3) N(3) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:22:25" | xref | date_time_modified "2006-11-09 10:22:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:552] === UNIMOD:552 Cys→Gly |
null .Term [UNIMOD:552] [cols="2*"] |
| id | UNIMOD:552 | name | Cys→Gly | def | "Cys→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=552] | xref | record_id "552" | xref | delta_mono_mass "-45.987721" | xref | delta_avge_mass "-46.0916" | xref | delta_composition "H(-2) C(-1) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:22:43" | xref | date_time_modified "2006-11-09 10:22:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:553] === UNIMOD:553 Asp→Ala |
null .Term [UNIMOD:553] [cols="2*"] |
| id | UNIMOD:553 | name | Asp→Ala | def | "Asp→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=553] | xref | record_id "553" | xref | delta_mono_mass "-43.989829" | xref | delta_avge_mass "-44.0095" | xref | delta_composition "C(-1) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:53:54" | xref | date_time_modified "2006-11-09 10:53:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:554] === UNIMOD:554 Asp→His |
null .Term [UNIMOD:554] [cols="2*"] |
| id | UNIMOD:554 | name | Asp→His | def | "Asp→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=554] | xref | record_id "554" | xref | delta_mono_mass "22.031969" | xref | delta_avge_mass "22.0519" | xref | delta_composition "H(2) C(2) N(2) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:55:25" | xref | date_time_modified "2006-11-09 10:55:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:555] === UNIMOD:555 Asp→Asn |
null .Term [UNIMOD:555] [cols="2*"] |
| id | UNIMOD:555 | name | Asp→Asn | def | "Asp→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=555] | xref | record_id "555" | xref | delta_mono_mass "-0.984016" | xref | delta_avge_mass "-0.9848" | xref | delta_composition "H N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:55:49" | xref | date_time_modified "2006-11-09 10:55:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:556] === UNIMOD:556 Asp→Gly |
null .Term [UNIMOD:556] [cols="2*"] |
| id | UNIMOD:556 | name | Asp→Gly | def | "Asp→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=556] | xref | record_id "556" | xref | delta_mono_mass "-58.005479" | xref | delta_avge_mass "-58.0361" | xref | delta_composition "H(-2) C(-2) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:56:52" | xref | date_time_modified "2006-11-09 10:56:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:557] === UNIMOD:557 Asp→Tyr |
null .Term [UNIMOD:557] [cols="2*"] |
| id | UNIMOD:557 | name | Asp→Tyr | def | "Asp→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=557] | xref | record_id "557" | xref | delta_mono_mass "48.036386" | xref | delta_avge_mass "48.0859" | xref | delta_composition "H(4) C(5) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:58:23" | xref | date_time_modified "2006-11-09 10:58:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:558] === UNIMOD:558 Asp→Glu |
null .Term [UNIMOD:558] [cols="2*"] |
| id | UNIMOD:558 | name | Asp→Glu | def | "Asp→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=558] | xref | record_id "558" | xref | delta_mono_mass "14.01565" | xref | delta_avge_mass "14.0266" | xref | delta_composition "H(2) C" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:58:44" | xref | date_time_modified "2006-11-09 10:58:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:559] === UNIMOD:559 Asp→Val |
null .Term [UNIMOD:559] [cols="2*"] |
| id | UNIMOD:559 | name | Asp→Val | def | "Asp→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=559] | xref | record_id "559" | xref | delta_mono_mass "-15.958529" | xref | delta_avge_mass "-15.9563" | xref | delta_composition "H(4) C O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 10:59:02" | xref | date_time_modified "2006-11-09 10:59:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:560] === UNIMOD:560 Glu→Ala |
null .Term [UNIMOD:560] [cols="2*"] |
| id | UNIMOD:560 | name | Glu→Ala | def | "Glu→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=560] | xref | record_id "560" | xref | delta_mono_mass "-58.005479" | xref | delta_avge_mass "-58.0361" | xref | delta_composition "H(-2) C(-2) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:00:54" | xref | date_time_modified "2006-11-09 11:00:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:561] === UNIMOD:561 Glu→Gln |
null .Term [UNIMOD:561] [cols="2*"] |
| id | UNIMOD:561 | name | Glu→Gln | def | "Glu→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=561] | xref | record_id "561" | xref | delta_mono_mass "-0.984016" | xref | delta_avge_mass "-0.9848" | xref | delta_composition "H N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:01:29" | xref | date_time_modified "2006-11-09 11:01:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:562] === UNIMOD:562 Glu→Asp |
null .Term [UNIMOD:562] [cols="2*"] |
| id | UNIMOD:562 | name | Glu→Asp | def | "Glu→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=562] | xref | record_id "562" | xref | delta_mono_mass "-14.01565" | xref | delta_avge_mass "-14.0266" | xref | delta_composition "H(-2) C(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:01:53" | xref | date_time_modified "2006-11-09 11:01:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:563] === UNIMOD:563 Glu→Lys |
null .Term [UNIMOD:563] [cols="2*"] |
| id | UNIMOD:563 | name | Glu→Lys | def | "Glu→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=563] | xref | record_id "563" | xref | delta_mono_mass "-0.94763" | xref | delta_avge_mass "-0.9417" | xref | delta_composition "H(5) C N O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:02:15" | xref | date_time_modified "2006-11-09 11:02:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:564] === UNIMOD:564 Glu→Gly |
null .Term [UNIMOD:564] [cols="2*"] |
| id | UNIMOD:564 | name | Glu→Gly | def | "Glu→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=564] | xref | record_id "564" | xref | delta_mono_mass "-72.021129" | xref | delta_avge_mass "-72.0627" | xref | delta_composition "H(-4) C(-3) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:02:36" | xref | date_time_modified "2006-11-09 11:02:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:565] === UNIMOD:565 Glu→Val |
null .Term [UNIMOD:565] [cols="2*"] |
| id | UNIMOD:565 | name | Glu→Val | def | "Glu→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=565] | xref | record_id "565" | xref | delta_mono_mass "-29.974179" | xref | delta_avge_mass "-29.9829" | xref | delta_composition "H(2) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:03:02" | xref | date_time_modified "2006-11-09 11:03:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:566] === UNIMOD:566 Phe→Ser |
null .Term [UNIMOD:566] [cols="2*"] |
| id | UNIMOD:566 | name | Phe→Ser | def | "Phe→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=566] | xref | record_id "566" | xref | delta_mono_mass "-60.036386" | xref | delta_avge_mass "-60.0966" | xref | delta_composition "H(-4) C(-6) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:03:29" | xref | date_time_modified "2006-11-09 11:03:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:567] === UNIMOD:567 Phe→Cys |
null .Term [UNIMOD:567] [cols="2*"] |
| id | UNIMOD:567 | name | Phe→Cys | def | "Phe→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=567] | xref | record_id "567" | xref | delta_mono_mass "-44.059229" | xref | delta_avge_mass "-44.031" | xref | delta_composition "H(-4) C(-6) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:04:01" | xref | date_time_modified "2006-11-09 11:04:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:568] === UNIMOD:568 Phe→Xle |
null .Term [UNIMOD:568] [cols="2*"] |
| id | UNIMOD:568 | name | Phe→Xle | def | "Phe→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=568] | xref | record_id "568" | xref | delta_mono_mass "-33.98435" | xref | delta_avge_mass "-34.0162" | xref | delta_composition "H(2) C(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:05:41" | xref | date_time_modified "2011-06-21 15:10:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:569] === UNIMOD:569 Phe→Tyr |
null .Term [UNIMOD:569] [cols="2*"] |
| id | UNIMOD:569 | name | Phe→Tyr | def | "Phe→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=569] | xref | record_id "569" | xref | delta_mono_mass "15.994915" | xref | delta_avge_mass "15.9994" | xref | delta_composition "O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:06:56" | xref | date_time_modified "2006-11-09 11:06:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:570] === UNIMOD:570 Phe→Val |
null .Term [UNIMOD:570] [cols="2*"] |
| id | UNIMOD:570 | name | Phe→Val | def | "Phe→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=570] | xref | record_id "570" | xref | delta_mono_mass "-48" | xref | delta_avge_mass "-48.0428" | xref | delta_composition "C(-4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:07:20" | xref | date_time_modified "2006-11-09 11:07:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:571] === UNIMOD:571 Gly→Ala |
null .Term [UNIMOD:571] [cols="2*"] |
| id | UNIMOD:571 | name | Gly→Ala | def | "Gly→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=571] | xref | record_id "571" | xref | delta_mono_mass "14.01565" | xref | delta_avge_mass "14.0266" | xref | delta_composition "H(2) C" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:07:51" | xref | date_time_modified "2006-11-09 11:07:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:572] === UNIMOD:572 Gly→Ser |
null .Term [UNIMOD:572] [cols="2*"] |
| id | UNIMOD:572 | name | Gly→Ser | def | "Gly→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=572] | xref | record_id "572" | xref | delta_mono_mass "30.010565" | xref | delta_avge_mass "30.026" | xref | delta_composition "H(2) C O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:08:13" | xref | date_time_modified "2006-11-09 11:08:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:573] === UNIMOD:573 Gly→Trp |
null .Term [UNIMOD:573] [cols="2*"] |
| id | UNIMOD:573 | name | Gly→Trp | def | "Gly→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=573] | xref | record_id "573" | xref | delta_mono_mass "129.057849" | xref | delta_avge_mass "129.1586" | xref | delta_composition "H(7) C(9) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:08:33" | xref | date_time_modified "2006-11-09 11:08:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:574] === UNIMOD:574 Gly→Glu |
null .Term [UNIMOD:574] [cols="2*"] |
| id | UNIMOD:574 | name | Gly→Glu | def | "Gly→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=574] | xref | record_id "574" | xref | delta_mono_mass "72.021129" | xref | delta_avge_mass "72.0627" | xref | delta_composition "H(4) C(3) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:08:57" | xref | date_time_modified "2006-11-09 11:08:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:575] === UNIMOD:575 Gly→Val |
null .Term [UNIMOD:575] [cols="2*"] |
| id | UNIMOD:575 | name | Gly→Val | def | "Gly→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=575] | xref | record_id "575" | xref | delta_mono_mass "42.04695" | xref | delta_avge_mass "42.0797" | xref | delta_composition "H(6) C(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:09:18" | xref | date_time_modified "2006-11-09 11:09:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:576] === UNIMOD:576 Gly→Asp |
null .Term [UNIMOD:576] [cols="2*"] |
| id | UNIMOD:576 | name | Gly→Asp | def | "Gly→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=576] | xref | record_id "576" | xref | delta_mono_mass "58.005479" | xref | delta_avge_mass "58.0361" | xref | delta_composition "H(2) C(2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:09:44" | xref | date_time_modified "2006-11-09 11:09:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:577] === UNIMOD:577 Gly→Cys |
null .Term [UNIMOD:577] [cols="2*"] |
| id | UNIMOD:577 | name | Gly→Cys | def | "Gly→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=577] | xref | record_id "577" | xref | delta_mono_mass "45.987721" | xref | delta_avge_mass "46.0916" | xref | delta_composition "H(2) C S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:10:03" | xref | date_time_modified "2006-11-09 11:10:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:578] === UNIMOD:578 Gly→Arg |
null .Term [UNIMOD:578] [cols="2*"] |
| id | UNIMOD:578 | name | Gly→Arg | def | "Gly→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=578] | xref | record_id "578" | xref | delta_mono_mass "99.079647" | xref | delta_avge_mass "99.1344" | xref | delta_composition "H(9) C(4) N(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:10:23" | xref | date_time_modified "2006-11-09 11:10:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:580] === UNIMOD:580 His→Pro |
null .Term [UNIMOD:580] [cols="2*"] |
| id | UNIMOD:580 | name | His→Pro | def | "His→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=580] | xref | record_id "580" | xref | delta_mono_mass "-40.006148" | xref | delta_avge_mass "-40.0241" | xref | delta_composition "C(-1) N(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:11:29" | xref | date_time_modified "2006-11-09 11:11:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:581] === UNIMOD:581 His→Tyr |
null .Term [UNIMOD:581] [cols="2*"] |
| id | UNIMOD:581 | name | His→Tyr | def | "His→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=581] | xref | record_id "581" | xref | delta_mono_mass "26.004417" | xref | delta_avge_mass "26.034" | xref | delta_composition "H(2) C(3) N(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:11:50" | xref | date_time_modified "2006-11-09 11:11:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:582] === UNIMOD:582 His→Gln |
null .Term [UNIMOD:582] [cols="2*"] |
| id | UNIMOD:582 | name | His→Gln | def | "His→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=582] | xref | record_id "582" | xref | delta_mono_mass "-9.000334" | xref | delta_avge_mass "-9.0101" | xref | delta_composition "H C(-1) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:14:42" | xref | date_time_modified "2006-11-09 11:14:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:584] === UNIMOD:584 His→Arg |
null .Term [UNIMOD:584] [cols="2*"] |
| id | UNIMOD:584 | name | His→Arg | def | "His→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=584] | xref | record_id "584" | xref | delta_mono_mass "19.042199" | xref | delta_avge_mass "19.0464" | xref | delta_composition "H(5) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:15:26" | xref | date_time_modified "2006-11-09 11:15:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:585] === UNIMOD:585 His→Xle |
null .Term [UNIMOD:585] [cols="2*"] |
| id | UNIMOD:585 | name | His→Xle | def | "His→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=585] | xref | record_id "585" | xref | delta_mono_mass "-23.974848" | xref | delta_avge_mass "-23.9816" | xref | delta_composition "H(4) N(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:15:51" | xref | date_time_modified "2011-06-21 15:10:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:588] === UNIMOD:588 Xle→Thr |
null .Term [UNIMOD:588] [cols="2*"] |
| id | UNIMOD:588 | name | Xle→Thr | def | "Leu/Ile→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=588] | xref | record_id "588" | xref | delta_mono_mass "-12.036386" | xref | delta_avge_mass "-12.0538" | xref | delta_composition "H(-4) C(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:18:09" | xref | date_time_modified "2011-06-21 15:29:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "I" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "L" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:589] === UNIMOD:589 Xle→Asn |
null .Term [UNIMOD:589] [cols="2*"] |
| id | UNIMOD:589 | name | Xle→Asn | def | "Leu/Ile→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=589] | xref | record_id "589" | xref | delta_mono_mass "0.958863" | xref | delta_avge_mass "0.945" | xref | delta_composition "H(-5) C(-2) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:18:31" | xref | date_time_modified "2011-06-21 15:29:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "I" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "L" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:590] === UNIMOD:590 Xle→Lys |
null .Term [UNIMOD:590] [cols="2*"] |
| id | UNIMOD:590 | name | Xle→Lys | def | "Leu/Ile→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=590] | xref | record_id "590" | xref | delta_mono_mass "15.010899" | xref | delta_avge_mass "15.0146" | xref | delta_composition "H N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:18:57" | xref | date_time_modified "2011-06-21 15:27:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "I" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "L" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:594] === UNIMOD:594 Lys→Thr |
null .Term [UNIMOD:594] [cols="2*"] |
| id | UNIMOD:594 | name | Lys→Thr | def | "Lys→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=594] | xref | record_id "594" | xref | delta_mono_mass "-27.047285" | xref | delta_avge_mass "-27.0684" | xref | delta_composition "H(-5) C(-2) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:20:28" | xref | date_time_modified "2006-11-09 11:20:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:595] === UNIMOD:595 Lys→Asn |
null .Term [UNIMOD:595] [cols="2*"] |
| id | UNIMOD:595 | name | Lys→Asn | def | "Lys→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=595] | xref | record_id "595" | xref | delta_mono_mass "-14.052036" | xref | delta_avge_mass "-14.0696" | xref | delta_composition "H(-6) C(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:20:51" | xref | date_time_modified "2006-11-09 11:20:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:596] === UNIMOD:596 Lys→Glu |
null .Term [UNIMOD:596] [cols="2*"] |
| id | UNIMOD:596 | name | Lys→Glu | def | "Lys→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=596] | xref | record_id "596" | xref | delta_mono_mass "0.94763" | xref | delta_avge_mass "0.9417" | xref | delta_composition "H(-5) C(-1) N(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:21:12" | xref | date_time_modified "2006-11-09 11:21:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:597] === UNIMOD:597 Lys→Gln |
null .Term [UNIMOD:597] [cols="2*"] |
| id | UNIMOD:597 | name | Lys→Gln | def | "Lys→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=597] | xref | record_id "597" | xref | delta_mono_mass "-0.036386" | xref | delta_avge_mass "-0.0431" | xref | delta_composition "H(-4) C(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:21:32" | xref | date_time_modified "2006-11-09 11:21:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:598] === UNIMOD:598 Lys→Met |
null .Term [UNIMOD:598] [cols="2*"] |
| id | UNIMOD:598 | name | Lys→Met | def | "Lys→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=598] | xref | record_id "598" | xref | delta_mono_mass "2.945522" | xref | delta_avge_mass "3.0238" | xref | delta_composition "H(-3) C(-1) N(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:21:56" | xref | date_time_modified "2006-11-09 11:21:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:599] === UNIMOD:599 Lys→Arg |
null .Term [UNIMOD:599] [cols="2*"] |
| id | UNIMOD:599 | name | Lys→Arg | def | "Lys→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=599] | xref | record_id "599" | xref | delta_mono_mass "28.006148" | xref | delta_avge_mass "28.0134" | xref | delta_composition "N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:22:15" | xref | date_time_modified "2006-11-09 11:22:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:600] === UNIMOD:600 Lys→Xle |
null .Term [UNIMOD:600] [cols="2*"] |
| id | UNIMOD:600 | name | Lys→Xle | def | "Lys→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=600] | xref | record_id "600" | xref | delta_mono_mass "-15.010899" | xref | delta_avge_mass "-15.0146" | xref | delta_composition "H(-1) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:22:38" | xref | date_time_modified "2011-06-21 15:25:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:601] === UNIMOD:601 Xle→Ser |
null .Term [UNIMOD:601] [cols="2*"] |
| id | UNIMOD:601 | name | Xle→Ser | def | "Leu/Ile→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=601] | xref | record_id "601" | xref | delta_mono_mass "-26.052036" | xref | delta_avge_mass "-26.0803" | xref | delta_composition "H(-6) C(-3) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:23:01" | xref | date_time_modified "2011-06-21 15:29:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:602] === UNIMOD:602 Xle→Phe |
null .Term [UNIMOD:602] [cols="2*"] |
| id | UNIMOD:602 | name | Xle→Phe | def | "Leu/Ile→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=602] | xref | record_id "602" | xref | delta_mono_mass "33.98435" | xref | delta_avge_mass "34.0162" | xref | delta_composition "H(-2) C(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:23:22" | xref | date_time_modified "2011-06-21 15:28:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:603] === UNIMOD:603 Xle→Trp |
null .Term [UNIMOD:603] [cols="2*"] |
| id | UNIMOD:603 | name | Xle→Trp | def | "Leu/Ile→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=603] | xref | record_id "603" | xref | delta_mono_mass "72.995249" | xref | delta_avge_mass "73.0523" | xref | delta_composition "H(-1) C(5) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:23:48" | xref | date_time_modified "2011-06-21 15:28:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:604] === UNIMOD:604 Xle→Pro |
null .Term [UNIMOD:604] [cols="2*"] |
| id | UNIMOD:604 | name | Xle→Pro | def | "Leu/Ile→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=604] | xref | record_id "604" | xref | delta_mono_mass "-16.0313" | xref | delta_avge_mass "-16.0425" | xref | delta_composition "H(-4) C(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:24:06" | xref | date_time_modified "2011-06-21 15:29:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:605] === UNIMOD:605 Xle→Val |
null .Term [UNIMOD:605] [cols="2*"] |
| id | UNIMOD:605 | name | Xle→Val | def | "Leu/Ile→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=605] | xref | record_id "605" | xref | delta_mono_mass "-14.01565" | xref | delta_avge_mass "-14.0266" | xref | delta_composition "H(-2) C(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:24:28" | xref | date_time_modified "2011-06-21 15:28:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:606] === UNIMOD:606 Xle→His |
null .Term [UNIMOD:606] [cols="2*"] |
| id | UNIMOD:606 | name | Xle→His | def | "Leu/Ile→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=606] | xref | record_id "606" | xref | delta_mono_mass "23.974848" | xref | delta_avge_mass "23.9816" | xref | delta_composition "H(-4) N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:24:50" | xref | date_time_modified "2011-06-21 15:29:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:607] === UNIMOD:607 Xle→Gln |
null .Term [UNIMOD:607] [cols="2*"] |
| id | UNIMOD:607 | name | Xle→Gln | def | "Leu/Ile→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=607] | xref | record_id "607" | xref | delta_mono_mass "14.974514" | xref | delta_avge_mass "14.9716" | xref | delta_composition "H(-3) C(-1) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:25:14" | xref | date_time_modified "2011-06-21 15:29:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:608] === UNIMOD:608 Xle→Met |
null .Term [UNIMOD:608] [cols="2*"] |
| id | UNIMOD:608 | name | Xle→Met | def | "Leu/Ile→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=608] | xref | record_id "608" | xref | delta_mono_mass "17.956421" | xref | delta_avge_mass "18.0384" | xref | delta_composition "H(-2) C(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:25:59" | xref | date_time_modified "2011-06-21 15:28:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:609] === UNIMOD:609 Xle→Arg |
null .Term [UNIMOD:609] [cols="2*"] |
| id | UNIMOD:609 | name | Xle→Arg | def | "Leu/Ile→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=609] | xref | record_id "609" | xref | delta_mono_mass "43.017047" | xref | delta_avge_mass "43.028" | xref | delta_composition "H N(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:26:21" | xref | date_time_modified "2011-06-21 15:28:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:610] === UNIMOD:610 Met→Thr |
null .Term [UNIMOD:610] [cols="2*"] |
| id | UNIMOD:610 | name | Met→Thr | def | "Met→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=610] | xref | record_id "610" | xref | delta_mono_mass "-29.992806" | xref | delta_avge_mass "-30.0922" | xref | delta_composition "H(-2) C(-1) O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:26:47" | xref | date_time_modified "2006-11-09 11:26:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:611] === UNIMOD:611 Met→Arg |
null .Term [UNIMOD:611] [cols="2*"] |
| id | UNIMOD:611 | name | Met→Arg | def | "Met→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=611] | xref | record_id "611" | xref | delta_mono_mass "25.060626" | xref | delta_avge_mass "24.9896" | xref | delta_composition "H(3) C N(3) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:27:10" | xref | date_time_modified "2006-11-09 11:27:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:613] === UNIMOD:613 Met→Lys |
null .Term [UNIMOD:613] [cols="2*"] |
| id | UNIMOD:613 | name | Met→Lys | def | "Met→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=613] | xref | record_id "613" | xref | delta_mono_mass "-2.945522" | xref | delta_avge_mass "-3.0238" | xref | delta_composition "H(3) C N S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:28:29" | xref | date_time_modified "2006-11-09 11:28:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:614] === UNIMOD:614 Met→Xle |
null .Term [UNIMOD:614] [cols="2*"] |
| id | UNIMOD:614 | name | Met→Xle | def | "Met→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=614] | synonym | "Also Met→norleucine" [] | xref | record_id "614" | xref | delta_mono_mass "-17.956421" | xref | delta_avge_mass "-18.0384" | xref | delta_composition "H(2) C S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:28:56" | xref | date_time_modified "2018-02-28 16:07:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:615] === UNIMOD:615 Met→Val |
null .Term [UNIMOD:615] [cols="2*"] |
| id | UNIMOD:615 | name | Met→Val | def | "Met→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=615] | xref | record_id "615" | xref | delta_mono_mass "-31.972071" | xref | delta_avge_mass "-32.065" | xref | delta_composition "S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:29:27" | xref | date_time_modified "2006-11-09 11:29:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:616] === UNIMOD:616 Asn→Ser |
null .Term [UNIMOD:616] [cols="2*"] |
| id | UNIMOD:616 | name | Asn→Ser | def | "Asn→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=616] | xref | record_id "616" | xref | delta_mono_mass "-27.010899" | xref | delta_avge_mass "-27.0253" | xref | delta_composition "H(-1) C(-1) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:29:57" | xref | date_time_modified "2006-11-09 11:29:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:617] === UNIMOD:617 Asn→Thr |
null .Term [UNIMOD:617] [cols="2*"] |
| id | UNIMOD:617 | name | Asn→Thr | def | "Asn→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=617] | xref | record_id "617" | xref | delta_mono_mass "-12.995249" | xref | delta_avge_mass "-12.9988" | xref | delta_composition "H N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:34:11" | xref | date_time_modified "2006-11-09 11:34:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:618] === UNIMOD:618 Asn→Lys |
null .Term [UNIMOD:618] [cols="2*"] |
| id | UNIMOD:618 | name | Asn→Lys | def | "Asn→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=618] | xref | record_id "618" | xref | delta_mono_mass "14.052036" | xref | delta_avge_mass "14.0696" | xref | delta_composition "H(6) C(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:34:31" | xref | date_time_modified "2006-11-09 11:34:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:619] === UNIMOD:619 Asn→Tyr |
null .Term [UNIMOD:619] [cols="2*"] |
| id | UNIMOD:619 | name | Asn→Tyr | def | "Asn→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=619] | xref | record_id "619" | xref | delta_mono_mass "49.020401" | xref | delta_avge_mass "49.0706" | xref | delta_composition "H(3) C(5) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:34:56" | xref | date_time_modified "2006-11-09 11:34:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:620] === UNIMOD:620 Asn→His |
null .Term [UNIMOD:620] [cols="2*"] |
| id | UNIMOD:620 | name | Asn→His | def | "Asn→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=620] | xref | record_id "620" | xref | delta_mono_mass "23.015984" | xref | delta_avge_mass "23.0366" | xref | delta_composition "H C(2) N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:35:18" | xref | date_time_modified "2006-11-09 11:35:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:621] === UNIMOD:621 Asn→Asp |
null .Term [UNIMOD:621] [cols="2*"] |
| id | UNIMOD:621 | name | Asn→Asp | def | "Asn→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=621] | xref | record_id "621" | xref | delta_mono_mass "0.984016" | xref | delta_avge_mass "0.9848" | xref | delta_composition "H(-1) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:35:42" | xref | date_time_modified "2006-11-09 11:35:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:622] === UNIMOD:622 Asn→Xle |
null .Term [UNIMOD:622] [cols="2*"] |
| id | UNIMOD:622 | name | Asn→Xle | def | "Asn→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=622] | xref | record_id "622" | xref | delta_mono_mass "-0.958863" | xref | delta_avge_mass "-0.945" | xref | delta_composition "H(5) C(2) N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:36:02" | xref | date_time_modified "2011-06-21 15:13:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:623] === UNIMOD:623 Pro→Ser |
null .Term [UNIMOD:623] [cols="2*"] |
| id | UNIMOD:623 | name | Pro→Ser | def | "Pro→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=623] | xref | record_id "623" | xref | delta_mono_mass "-10.020735" | xref | delta_avge_mass "-10.0379" | xref | delta_composition "H(-2) C(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:36:26" | xref | date_time_modified "2006-11-09 11:36:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:624] === UNIMOD:624 Pro→Ala |
null .Term [UNIMOD:624] [cols="2*"] |
| id | UNIMOD:624 | name | Pro→Ala | def | "Pro→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=624] | xref | record_id "624" | xref | delta_mono_mass "-26.01565" | xref | delta_avge_mass "-26.0373" | xref | delta_composition "H(-2) C(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:37:56" | xref | date_time_modified "2006-11-09 11:37:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:625] === UNIMOD:625 Pro→His |
null .Term [UNIMOD:625] [cols="2*"] |
| id | UNIMOD:625 | name | Pro→His | def | "Pro→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=625] | xref | record_id "625" | xref | delta_mono_mass "40.006148" | xref | delta_avge_mass "40.0241" | xref | delta_composition "C N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:38:18" | xref | date_time_modified "2006-11-09 11:38:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:626] === UNIMOD:626 Pro→Gln |
null .Term [UNIMOD:626] [cols="2*"] |
| id | UNIMOD:626 | name | Pro→Gln | def | "Pro→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=626] | xref | record_id "626" | xref | delta_mono_mass "31.005814" | xref | delta_avge_mass "31.014" | xref | delta_composition "H N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:38:40" | xref | date_time_modified "2006-11-09 11:38:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:627] === UNIMOD:627 Pro→Thr |
null .Term [UNIMOD:627] [cols="2*"] |
| id | UNIMOD:627 | name | Pro→Thr | def | "Pro→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=627] | xref | record_id "627" | xref | delta_mono_mass "3.994915" | xref | delta_avge_mass "3.9887" | xref | delta_composition "C(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:39:02" | xref | date_time_modified "2006-11-09 11:39:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:628] === UNIMOD:628 Pro→Arg |
null .Term [UNIMOD:628] [cols="2*"] |
| id | UNIMOD:628 | name | Pro→Arg | def | "Pro→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=628] | xref | record_id "628" | xref | delta_mono_mass "59.048347" | xref | delta_avge_mass "59.0705" | xref | delta_composition "H(5) C N(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:39:29" | xref | date_time_modified "2006-11-09 11:39:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:629] === UNIMOD:629 Pro→Xle |
null .Term [UNIMOD:629] [cols="2*"] |
| id | UNIMOD:629 | name | Pro→Xle | def | "Pro→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=629] | xref | record_id "629" | xref | delta_mono_mass "16.0313" | xref | delta_avge_mass "16.0425" | xref | delta_composition "H(4) C" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:39:47" | xref | date_time_modified "2011-06-21 15:09:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:630] === UNIMOD:630 Gln→Pro |
null .Term [UNIMOD:630] [cols="2*"] |
| id | UNIMOD:630 | name | Gln→Pro | def | "Gln→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=630] | xref | record_id "630" | xref | delta_mono_mass "-31.005814" | xref | delta_avge_mass "-31.014" | xref | delta_composition "H(-1) N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:40:19" | xref | date_time_modified "2006-11-09 11:40:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:631] === UNIMOD:631 Gln→Lys |
null .Term [UNIMOD:631] [cols="2*"] |
| id | UNIMOD:631 | name | Gln→Lys | def | "Gln→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=631] | xref | record_id "631" | xref | delta_mono_mass "0.036386" | xref | delta_avge_mass "0.0431" | xref | delta_composition "H(4) C O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:42:17" | xref | date_time_modified "2006-11-09 11:42:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:632] === UNIMOD:632 Gln→Glu |
null .Term [UNIMOD:632] [cols="2*"] |
| id | UNIMOD:632 | name | Gln→Glu | def | "Gln→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=632] | xref | record_id "632" | xref | delta_mono_mass "0.984016" | xref | delta_avge_mass "0.9848" | xref | delta_composition "H(-1) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:42:38" | xref | date_time_modified "2006-11-09 11:42:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:633] === UNIMOD:633 Gln→His |
null .Term [UNIMOD:633] [cols="2*"] |
| id | UNIMOD:633 | name | Gln→His | def | "Gln→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=633] | xref | record_id "633" | xref | delta_mono_mass "9.000334" | xref | delta_avge_mass "9.0101" | xref | delta_composition "H(-1) C N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:42:58" | xref | date_time_modified "2006-11-09 11:42:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:634] === UNIMOD:634 Gln→Arg |
null .Term [UNIMOD:634] [cols="2*"] |
| id | UNIMOD:634 | name | Gln→Arg | def | "Gln→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=634] | xref | record_id "634" | xref | delta_mono_mass "28.042534" | xref | delta_avge_mass "28.0565" | xref | delta_composition "H(4) C N(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:43:25" | xref | date_time_modified "2006-11-09 11:43:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:635] === UNIMOD:635 Gln→Xle |
null .Term [UNIMOD:635] [cols="2*"] |
| id | UNIMOD:635 | name | Gln→Xle | def | "Gln→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=635] | xref | record_id "635" | xref | delta_mono_mass "-14.974514" | xref | delta_avge_mass "-14.9716" | xref | delta_composition "H(3) C N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:43:47" | xref | date_time_modified "2011-06-21 15:09:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:636] === UNIMOD:636 Arg→Ser |
null .Term [UNIMOD:636] [cols="2*"] |
| id | UNIMOD:636 | name | Arg→Ser | def | "Arg→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=636] | xref | record_id "636" | xref | delta_mono_mass "-69.069083" | xref | delta_avge_mass "-69.1084" | xref | delta_composition "H(-7) C(-3) N(-3) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:44:13" | xref | date_time_modified "2006-11-09 11:44:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:637] === UNIMOD:637 Arg→Trp |
null .Term [UNIMOD:637] [cols="2*"] |
| id | UNIMOD:637 | name | Arg→Trp | def | "Arg→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=637] | xref | record_id "637" | xref | delta_mono_mass "29.978202" | xref | delta_avge_mass "30.0242" | xref | delta_composition "H(-2) C(5) N(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:44:36" | xref | date_time_modified "2006-11-09 11:44:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:638] === UNIMOD:638 Arg→Thr |
null .Term [UNIMOD:638] [cols="2*"] |
| id | UNIMOD:638 | name | Arg→Thr | def | "Arg→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=638] | xref | record_id "638" | xref | delta_mono_mass "-55.053433" | xref | delta_avge_mass "-55.0818" | xref | delta_composition "H(-5) C(-2) N(-3) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:44:59" | xref | date_time_modified "2006-11-09 11:44:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:639] === UNIMOD:639 Arg→Pro |
null .Term [UNIMOD:639] [cols="2*"] |
| id | UNIMOD:639 | name | Arg→Pro | def | "Arg→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=639] | xref | record_id "639" | xref | delta_mono_mass "-59.048347" | xref | delta_avge_mass "-59.0705" | xref | delta_composition "H(-5) C(-1) N(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:45:18" | xref | date_time_modified "2006-11-09 11:45:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:640] === UNIMOD:640 Arg→Lys |
null .Term [UNIMOD:640] [cols="2*"] |
| id | UNIMOD:640 | name | Arg→Lys | def | "Arg→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=640] | xref | record_id "640" | xref | delta_mono_mass "-28.006148" | xref | delta_avge_mass "-28.0134" | xref | delta_composition "N(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:45:37" | xref | date_time_modified "2006-11-09 11:45:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:641] === UNIMOD:641 Arg→His |
null .Term [UNIMOD:641] [cols="2*"] |
| id | UNIMOD:641 | name | Arg→His | def | "Arg→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=641] | xref | record_id "641" | xref | delta_mono_mass "-19.042199" | xref | delta_avge_mass "-19.0464" | xref | delta_composition "H(-5) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:45:56" | xref | date_time_modified "2006-11-09 11:45:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:642] === UNIMOD:642 Arg→Gln |
null .Term [UNIMOD:642] [cols="2*"] |
| id | UNIMOD:642 | name | Arg→Gln | def | "Arg→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=642] | xref | record_id "642" | xref | delta_mono_mass "-28.042534" | xref | delta_avge_mass "-28.0565" | xref | delta_composition "H(-4) C(-1) N(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:46:17" | xref | date_time_modified "2006-11-09 11:46:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:643] === UNIMOD:643 Arg→Met |
null .Term [UNIMOD:643] [cols="2*"] |
| id | UNIMOD:643 | name | Arg→Met | def | "Arg→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=643] | xref | record_id "643" | xref | delta_mono_mass "-25.060626" | xref | delta_avge_mass "-24.9896" | xref | delta_composition "H(-3) C(-1) N(-3) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:46:37" | xref | date_time_modified "2006-11-09 11:46:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:644] === UNIMOD:644 Arg→Cys |
null .Term [UNIMOD:644] [cols="2*"] |
| id | UNIMOD:644 | name | Arg→Cys | def | "Arg→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=644] | xref | record_id "644" | xref | delta_mono_mass "-53.091927" | xref | delta_avge_mass "-53.0428" | xref | delta_composition "H(-7) C(-3) N(-3) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:47:00" | xref | date_time_modified "2006-11-09 11:47:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:645] === UNIMOD:645 Arg→Xle |
null .Term [UNIMOD:645] [cols="2*"] |
| id | UNIMOD:645 | name | Arg→Xle | def | "Arg→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=645] | xref | record_id "645" | xref | delta_mono_mass "-43.017047" | xref | delta_avge_mass "-43.028" | xref | delta_composition "H(-1) N(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:47:36" | xref | date_time_modified "2011-06-21 15:09:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:646] === UNIMOD:646 Arg→Gly |
null .Term [UNIMOD:646] [cols="2*"] |
| id | UNIMOD:646 | name | Arg→Gly | def | "Arg→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=646] | xref | record_id "646" | xref | delta_mono_mass "-99.079647" | xref | delta_avge_mass "-99.1344" | xref | delta_composition "H(-9) C(-4) N(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 11:48:00" | xref | date_time_modified "2006-11-09 11:48:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:647] === UNIMOD:647 Ser→Phe |
null .Term [UNIMOD:647] [cols="2*"] |
| id | UNIMOD:647 | name | Ser→Phe | def | "Ser→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=647] | xref | record_id "647" | xref | delta_mono_mass "60.036386" | xref | delta_avge_mass "60.0966" | xref | delta_composition "H(4) C(6) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:32:55" | xref | date_time_modified "2006-11-09 12:32:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:648] === UNIMOD:648 Ser→Ala |
null .Term [UNIMOD:648] [cols="2*"] |
| id | UNIMOD:648 | name | Ser→Ala | def | "Ser→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=648] | xref | record_id "648" | xref | delta_mono_mass "-15.994915" | xref | delta_avge_mass "-15.9994" | xref | delta_composition "O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:33:14" | xref | date_time_modified "2006-11-09 12:33:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:649] === UNIMOD:649 Ser→Trp |
null .Term [UNIMOD:649] [cols="2*"] |
| id | UNIMOD:649 | name | Ser→Trp | def | "Ser→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=649] | xref | record_id "649" | xref | delta_mono_mass "99.047285" | xref | delta_avge_mass "99.1326" | xref | delta_composition "H(5) C(8) N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:33:32" | xref | date_time_modified "2006-11-09 12:33:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:650] === UNIMOD:650 Ser→Thr |
null .Term [UNIMOD:650] [cols="2*"] |
| id | UNIMOD:650 | name | Ser→Thr | def | "Ser→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=650] | xref | record_id "650" | xref | delta_mono_mass "14.01565" | xref | delta_avge_mass "14.0266" | xref | delta_composition "H(2) C" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:33:51" | xref | date_time_modified "2006-11-09 12:33:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:651] === UNIMOD:651 Ser→Asn |
null .Term [UNIMOD:651] [cols="2*"] |
| id | UNIMOD:651 | name | Ser→Asn | def | "Ser→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=651] | xref | record_id "651" | xref | delta_mono_mass "27.010899" | xref | delta_avge_mass "27.0253" | xref | delta_composition "H C N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:34:12" | xref | date_time_modified "2006-11-09 12:34:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:652] === UNIMOD:652 Ser→Pro |
null .Term [UNIMOD:652] [cols="2*"] |
| id | UNIMOD:652 | name | Ser→Pro | def | "Ser→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=652] | xref | record_id "652" | xref | delta_mono_mass "10.020735" | xref | delta_avge_mass "10.0379" | xref | delta_composition "H(2) C(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:34:34" | xref | date_time_modified "2006-11-09 12:34:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:653] === UNIMOD:653 Ser→Tyr |
null .Term [UNIMOD:653] [cols="2*"] |
| id | UNIMOD:653 | name | Ser→Tyr | def | "Ser→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=653] | xref | record_id "653" | xref | delta_mono_mass "76.0313" | xref | delta_avge_mass "76.096" | xref | delta_composition "H(4) C(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:35:00" | xref | date_time_modified "2006-11-09 12:35:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:654] === UNIMOD:654 Ser→Cys |
null .Term [UNIMOD:654] [cols="2*"] |
| id | UNIMOD:654 | name | Ser→Cys | def | "Ser→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=654] | xref | record_id "654" | xref | delta_mono_mass "15.977156" | xref | delta_avge_mass "16.0656" | xref | delta_composition "O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:35:22" | xref | date_time_modified "2006-11-09 12:35:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:655] === UNIMOD:655 Ser→Arg |
null .Term [UNIMOD:655] [cols="2*"] |
| id | UNIMOD:655 | name | Ser→Arg | def | "Ser→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=655] | xref | record_id "655" | xref | delta_mono_mass "69.069083" | xref | delta_avge_mass "69.1084" | xref | delta_composition "H(7) C(3) N(3) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:35:40" | xref | date_time_modified "2006-11-09 12:35:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:656] === UNIMOD:656 Ser→Xle |
null .Term [UNIMOD:656] [cols="2*"] |
| id | UNIMOD:656 | name | Ser→Xle | def | "Ser→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=656] | xref | record_id "656" | xref | delta_mono_mass "26.052036" | xref | delta_avge_mass "26.0803" | xref | delta_composition "H(6) C(3) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:36:10" | xref | date_time_modified "2011-06-21 15:08:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:657] === UNIMOD:657 Ser→Gly |
null .Term [UNIMOD:657] [cols="2*"] |
| id | UNIMOD:657 | name | Ser→Gly | def | "Ser→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=657] | xref | record_id "657" | xref | delta_mono_mass "-30.010565" | xref | delta_avge_mass "-30.026" | xref | delta_composition "H(-2) C(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:36:34" | xref | date_time_modified "2006-11-09 12:36:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:658] === UNIMOD:658 Thr→Ser |
null .Term [UNIMOD:658] [cols="2*"] |
| id | UNIMOD:658 | name | Thr→Ser | def | "Thr→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=658] | xref | record_id "658" | xref | delta_mono_mass "-14.01565" | xref | delta_avge_mass "-14.0266" | xref | delta_composition "H(-2) C(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:36:57" | xref | date_time_modified "2006-11-09 12:36:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:659] === UNIMOD:659 Thr→Ala |
null .Term [UNIMOD:659] [cols="2*"] |
| id | UNIMOD:659 | name | Thr→Ala | def | "Thr→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=659] | xref | record_id "659" | xref | delta_mono_mass "-30.010565" | xref | delta_avge_mass "-30.026" | xref | delta_composition "H(-2) C(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:37:15" | xref | date_time_modified "2006-11-09 12:37:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:660] === UNIMOD:660 Thr→Asn |
null .Term [UNIMOD:660] [cols="2*"] |
| id | UNIMOD:660 | name | Thr→Asn | def | "Thr→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=660] | xref | record_id "660" | xref | delta_mono_mass "12.995249" | xref | delta_avge_mass "12.9988" | xref | delta_composition "H(-1) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:37:37" | xref | date_time_modified "2006-11-09 12:37:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:661] === UNIMOD:661 Thr→Lys |
null .Term [UNIMOD:661] [cols="2*"] |
| id | UNIMOD:661 | name | Thr→Lys | def | "Thr→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=661] | xref | record_id "661" | xref | delta_mono_mass "27.047285" | xref | delta_avge_mass "27.0684" | xref | delta_composition "H(5) C(2) N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:37:55" | xref | date_time_modified "2006-11-09 12:37:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:662] === UNIMOD:662 Thr→Pro |
null .Term [UNIMOD:662] [cols="2*"] |
| id | UNIMOD:662 | name | Thr→Pro | def | "Thr→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=662] | xref | record_id "662" | xref | delta_mono_mass "-3.994915" | xref | delta_avge_mass "-3.9887" | xref | delta_composition "C O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:38:14" | xref | date_time_modified "2006-11-09 12:38:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:663] === UNIMOD:663 Thr→Met |
null .Term [UNIMOD:663] [cols="2*"] |
| id | UNIMOD:663 | name | Thr→Met | def | "Thr→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=663] | xref | record_id "663" | xref | delta_mono_mass "29.992806" | xref | delta_avge_mass "30.0922" | xref | delta_composition "H(2) C O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:38:34" | xref | date_time_modified "2006-11-09 12:38:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:664] === UNIMOD:664 Thr→Xle |
null .Term [UNIMOD:664] [cols="2*"] |
| id | UNIMOD:664 | name | Thr→Xle | def | "Thr→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=664] | xref | record_id "664" | xref | delta_mono_mass "12.036386" | xref | delta_avge_mass "12.0538" | xref | delta_composition "H(4) C(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:38:56" | xref | date_time_modified "2011-06-21 15:25:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:665] === UNIMOD:665 Thr→Arg |
null .Term [UNIMOD:665] [cols="2*"] |
| id | UNIMOD:665 | name | Thr→Arg | def | "Thr→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=665] | xref | record_id "665" | xref | delta_mono_mass "55.053433" | xref | delta_avge_mass "55.0818" | xref | delta_composition "H(5) C(2) N(3) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:39:14" | xref | date_time_modified "2006-11-09 12:39:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:666] === UNIMOD:666 Val→Phe |
null .Term [UNIMOD:666] [cols="2*"] |
| id | UNIMOD:666 | name | Val→Phe | def | "Val→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=666] | xref | record_id "666" | xref | delta_mono_mass "48" | xref | delta_avge_mass "48.0428" | xref | delta_composition "C(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:39:35" | xref | date_time_modified "2006-11-09 12:39:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:667] === UNIMOD:667 Val→Ala |
null .Term [UNIMOD:667] [cols="2*"] |
| id | UNIMOD:667 | name | Val→Ala | def | "Val→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=667] | xref | record_id "667" | xref | delta_mono_mass "-28.0313" | xref | delta_avge_mass "-28.0532" | xref | delta_composition "H(-4) C(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:40:00" | xref | date_time_modified "2006-11-09 12:40:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:668] === UNIMOD:668 Val→Glu |
null .Term [UNIMOD:668] [cols="2*"] |
| id | UNIMOD:668 | name | Val→Glu | def | "Val→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=668] | xref | record_id "668" | xref | delta_mono_mass "29.974179" | xref | delta_avge_mass "29.9829" | xref | delta_composition "H(-2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:40:19" | xref | date_time_modified "2006-11-09 12:40:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:669] === UNIMOD:669 Val→Met |
null .Term [UNIMOD:669] [cols="2*"] |
| id | UNIMOD:669 | name | Val→Met | def | "Val→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=669] | xref | record_id "669" | xref | delta_mono_mass "31.972071" | xref | delta_avge_mass "32.065" | xref | delta_composition "S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:40:36" | xref | date_time_modified "2006-11-09 12:40:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:670] === UNIMOD:670 Val→Asp |
null .Term [UNIMOD:670] [cols="2*"] |
| id | UNIMOD:670 | name | Val→Asp | def | "Val→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=670] | xref | record_id "670" | xref | delta_mono_mass "15.958529" | xref | delta_avge_mass "15.9563" | xref | delta_composition "H(-4) C(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:41:04" | xref | date_time_modified "2006-11-09 12:41:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:671] === UNIMOD:671 Val→Xle |
null .Term [UNIMOD:671] [cols="2*"] |
| id | UNIMOD:671 | name | Val→Xle | def | "Val→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=671] | xref | record_id "671" | xref | delta_mono_mass "14.01565" | xref | delta_avge_mass "14.0266" | xref | delta_composition "H(2) C" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:41:27" | xref | date_time_modified "2011-06-21 15:08:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:672] === UNIMOD:672 Val→Gly |
null .Term [UNIMOD:672] [cols="2*"] |
| id | UNIMOD:672 | name | Val→Gly | def | "Val→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=672] | xref | record_id "672" | xref | delta_mono_mass "-42.04695" | xref | delta_avge_mass "-42.0797" | xref | delta_composition "H(-6) C(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:41:45" | xref | date_time_modified "2006-11-09 12:41:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:673] === UNIMOD:673 Trp→Ser |
null .Term [UNIMOD:673] [cols="2*"] |
| id | UNIMOD:673 | name | Trp→Ser | def | "Trp→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=673] | xref | record_id "673" | xref | delta_mono_mass "-99.047285" | xref | delta_avge_mass "-99.1326" | xref | delta_composition "H(-5) C(-8) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:42:22" | xref | date_time_modified "2006-11-09 12:42:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:674] === UNIMOD:674 Trp→Cys |
null .Term [UNIMOD:674] [cols="2*"] |
| id | UNIMOD:674 | name | Trp→Cys | def | "Trp→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=674] | xref | record_id "674" | xref | delta_mono_mass "-83.070128" | xref | delta_avge_mass "-83.067" | xref | delta_composition "H(-5) C(-8) N(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:42:46" | xref | date_time_modified "2006-11-09 12:42:46" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:675] === UNIMOD:675 Trp→Arg |
null .Term [UNIMOD:675] [cols="2*"] |
| id | UNIMOD:675 | name | Trp→Arg | def | "Trp→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=675] | xref | record_id "675" | xref | delta_mono_mass "-29.978202" | xref | delta_avge_mass "-30.0242" | xref | delta_composition "H(2) C(-5) N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:43:10" | xref | date_time_modified "2006-11-09 12:43:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:676] === UNIMOD:676 Trp→Gly |
null .Term [UNIMOD:676] [cols="2*"] |
| id | UNIMOD:676 | name | Trp→Gly | def | "Trp→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=676] | xref | record_id "676" | xref | delta_mono_mass "-129.057849" | xref | delta_avge_mass "-129.1586" | xref | delta_composition "H(-7) C(-9) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:43:29" | xref | date_time_modified "2006-11-09 12:43:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:677] === UNIMOD:677 Trp→Xle |
null .Term [UNIMOD:677] [cols="2*"] |
| id | UNIMOD:677 | name | Trp→Xle | def | "Trp→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=677] | xref | record_id "677" | xref | delta_mono_mass "-72.995249" | xref | delta_avge_mass "-73.0523" | xref | delta_composition "H C(-5) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:43:49" | xref | date_time_modified "2011-06-21 15:08:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:678] === UNIMOD:678 Tyr→Phe |
null .Term [UNIMOD:678] [cols="2*"] |
| id | UNIMOD:678 | name | Tyr→Phe | def | "Tyr→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=678] | xref | record_id "678" | xref | delta_mono_mass "-15.994915" | xref | delta_avge_mass "-15.9994" | xref | delta_composition "O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:44:13" | xref | date_time_modified "2006-11-09 12:44:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:679] === UNIMOD:679 Tyr→Ser |
null .Term [UNIMOD:679] [cols="2*"] |
| id | UNIMOD:679 | name | Tyr→Ser | def | "Tyr→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=679] | xref | record_id "679" | xref | delta_mono_mass "-76.0313" | xref | delta_avge_mass "-76.096" | xref | delta_composition "H(-4) C(-6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:44:37" | xref | date_time_modified "2006-11-09 12:44:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:680] === UNIMOD:680 Tyr→Asn |
null .Term [UNIMOD:680] [cols="2*"] |
| id | UNIMOD:680 | name | Tyr→Asn | def | "Tyr→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=680] | xref | record_id "680" | xref | delta_mono_mass "-49.020401" | xref | delta_avge_mass "-49.0706" | xref | delta_composition "H(-3) C(-5) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:44:59" | xref | date_time_modified "2006-11-09 12:44:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:681] === UNIMOD:681 Tyr→His |
null .Term [UNIMOD:681] [cols="2*"] |
| id | UNIMOD:681 | name | Tyr→His | def | "Tyr→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=681] | xref | record_id "681" | xref | delta_mono_mass "-26.004417" | xref | delta_avge_mass "-26.034" | xref | delta_composition "H(-2) C(-3) N(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:45:22" | xref | date_time_modified "2006-11-09 12:45:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:682] === UNIMOD:682 Tyr→Asp |
null .Term [UNIMOD:682] [cols="2*"] |
| id | UNIMOD:682 | name | Tyr→Asp | def | "Tyr→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=682] | xref | record_id "682" | xref | delta_mono_mass "-48.036386" | xref | delta_avge_mass "-48.0859" | xref | delta_composition "H(-4) C(-5) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:45:44" | xref | date_time_modified "2006-11-09 12:45:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:683] === UNIMOD:683 Tyr→Cys |
null .Term [UNIMOD:683] [cols="2*"] |
| id | UNIMOD:683 | name | Tyr→Cys | def | "Tyr→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=683] | xref | record_id "683" | xref | delta_mono_mass "-60.054144" | xref | delta_avge_mass "-60.0304" | xref | delta_composition "H(-4) C(-6) O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-09 12:46:03" | xref | date_time_modified "2006-11-09 12:46:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:684] === UNIMOD:684 BDMAPP |
null .Term [UNIMOD:684] [cols="2*"] |
| id | UNIMOD:684 | name | BDMAPP | def | "Mass Defect Tag on lysine e-amino." [URL:http\://www.targetdiscovery.com/article.php?topic=crpc.prst&story=20060321132643690, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=684] | xref | record_id "684" | xref | delta_mono_mass "253.010225" | xref | delta_avge_mass "254.1231" | xref | delta_composition "H(12) C(11) N O Br" | xref | username_of_poster "LVSchneid" | xref | group_of_poster "" | xref | date_time_posted "2006-11-13 18:51:11" | xref | date_time_modified "2006-11-13 18:52:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_misc_notes "Low efficiency" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "Y" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Artefact" | xref | spec_4_misc_notes "Low efficiency" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "W" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Artefact" | xref | spec_5_misc_notes "Low efficiency" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:685] === UNIMOD:685 NA-LNO2 |
null .Term [UNIMOD:685] [cols="2*"] |
| id | UNIMOD:685 | name | NA-LNO2 | def | "Nitroalkylation by Nitro Linoleic Acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=685] | comment | Reversible post-translational modification of proteins by nitrated fatty acids. | synonym | "Michael addition of nitro-linoleic acid to Cys and His" [] | xref | record_id "685" | xref | delta_mono_mass "325.225309" | xref | delta_avge_mass "325.443" | xref | delta_composition "H(31) C(18) N O(4)" | xref | username_of_poster "cbatthya" | xref | group_of_poster "" | xref | date_time_posted "2006-11-13 18:59:35" | xref | date_time_modified "2006-11-13 18:59:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:686] === UNIMOD:686 NA-OA-NO2 |
null .Term [UNIMOD:686] [cols="2*"] |
| id | UNIMOD:686 | name | NA-OA-NO2 | def | "Nitroalkylation by Nitro Oleic Acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=686] | comment | Reversible post-translational modification of proteins by nitrated fatty acids. | synonym | "Michael addition of nitro-oleic acid to Cys and His" [] | xref | record_id "686" | xref | delta_mono_mass "327.240959" | xref | delta_avge_mass "327.4589" | xref | delta_composition "H(33) C(18) N O(4)" | xref | username_of_poster "cbatthya" | xref | group_of_poster "" | xref | date_time_posted "2006-11-13 19:01:33" | xref | date_time_modified "2006-11-13 19:01:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:687] === UNIMOD:687 ICPL:2H(4) |
null .Term [UNIMOD:687] [cols="2*"] |
| id | UNIMOD:687 | name | ICPL:2H(4) | def | "Bruker Daltonics SERVA-ICPL™ quantification chemistry, medium form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, PMID:15602776, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=687] | comment | Attention: As the digest is typically applied AFTER ICPL_light/heavy labeling, only ProteinN-term labeling and Lys-specific labeling is applied. | xref | record_id "687" | xref | delta_mono_mass "109.046571" | xref | delta_avge_mass "109.1188" | xref | delta_composition "H(-1) 2H(4) C(6) N O" | xref | username_of_poster "suckau" | xref | group_of_poster "" | xref | date_time_posted "2006-11-13 19:05:12" | xref | date_time_modified "2008-09-03 15:26:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_misc_notes "Use when labelling pre-digest" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Use when labelling post-digest" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:695] === UNIMOD:695 Label:13C(6)15N(1) |
null .Term [UNIMOD:695] [cols="2*"] |
| id | UNIMOD:695 | name | Label:13C(6)15N(1) | def | "13C(6) 15N(1) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=695] | xref | record_id "695" | xref | delta_mono_mass "7.017164" | xref | delta_avge_mass "6.9493" | xref | delta_composition "C(-6) 13C(6) N(-1) 15N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2006-11-29 15:10:53" | xref | date_time_modified "2007-08-22 18:30:49" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:696] === UNIMOD:696 Label:2H(9)13C(6)15N(2) |
null .Term [UNIMOD:696] [cols="2*"] |
| id | UNIMOD:696 | name | Label:2H(9)13C(6)15N(2) | def | "13C(6) 15N(2) (D)9 SILAC label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, URL:http\://www.isotope.com/cil/products/displayproduct.cfm?prod_id=8635, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=696] | synonym | "heavy D9 lysine" [] | xref | record_id "696" | xref | delta_mono_mass "17.07069" | xref | delta_avge_mass "16.9982" | xref | delta_composition "H(-9) 2H(9) C(-6) 13C(6) N(-2) 15N(2)" | xref | username_of_poster "striker2000" | xref | group_of_poster "" | xref | date_time_posted "2006-12-01 22:36:25" | xref | date_time_modified "2007-08-22 18:48:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in SILAC experiment" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:697] === UNIMOD:697 NIC |
null .Term [UNIMOD:697] [cols="2*"] |
| id | UNIMOD:697 | name | NIC | def | "Nicotinic Acid." [PMID:15004565, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=697] | xref | record_id "697" | xref | delta_mono_mass "105.021464" | xref | delta_avge_mass "105.0941" | xref | delta_composition "H(3) C(6) N O" | xref | username_of_poster "verena-meyer" | xref | group_of_poster "" | xref | date_time_posted "2006-12-04 16:04:56" | xref | date_time_modified "2014-07-09 16:57:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:698] === UNIMOD:698 dNIC |
null .Term [UNIMOD:698] [cols="2*"] |
| id | UNIMOD:698 | name | dNIC | def | "Deuterated Nicotinic Acid." [PMID:15004565, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=698] | xref | record_id "698" | xref | delta_mono_mass "109.048119" | xref | delta_avge_mass "109.1205" | xref | delta_composition "H 2H(3) C(6) N O" | xref | username_of_poster "verena-meyer" | xref | group_of_poster "" | xref | date_time_posted "2006-12-04 16:12:54" | xref | date_time_modified "2014-07-09 16:57:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:720] === UNIMOD:720 HNE-Delta:H(2)O |
null .Term [UNIMOD:720] [cols="2*"] |
| id | UNIMOD:720 | name | HNE-Delta:H(2)O | def | "Dehydrated 4-hydroxynonenal." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=720] | comment | Mass Spectroscopic Characterization of Protein Modification by 4-Hydroxy-2-(E)-nonenal and 4-Oxo-2-(E)-nonenal. | xref | record_id "720" | xref | delta_mono_mass "138.104465" | xref | delta_avge_mass "138.2069" | xref | delta_composition "H(14) C(9) O" | xref | username_of_poster "stewartb" | xref | group_of_poster "" | xref | date_time_posted "2007-01-08 18:29:46" | xref | date_time_modified "2007-01-21 18:27:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:721] === UNIMOD:721 4-ONE |
null .Term [UNIMOD:721] [cols="2*"] |
| id | UNIMOD:721 | name | 4-ONE | def | "4-Oxononenal (ONE)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=721] | comment | Covalent adduction of nucleophilic amino acids by 4-hydroxynonenal and 4-oxononenal. | xref | record_id "721" | xref | delta_mono_mass "154.09938" | xref | delta_avge_mass "154.2063" | xref | delta_composition "H(14) C(9) O(2)" | xref | username_of_poster "stewartb" | xref | group_of_poster "" | xref | date_time_posted "2007-01-08 19:41:28" | xref | date_time_modified "2007-01-21 18:26:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:723] === UNIMOD:723 O-Dimethylphosphate |
null .Term [UNIMOD:723] [cols="2*"] |
| id | UNIMOD:723 | name | O-Dimethylphosphate | def | "O-Dimethylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=723] | xref | record_id "723" | xref | delta_mono_mass "107.997631" | xref | delta_avge_mass "108.0331" | xref | delta_composition "H(5) C(2) O(3) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2007-01-09 21:25:28" | xref | date_time_modified "2007-01-13 21:01:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:724] === UNIMOD:724 O-Methylphosphate |
null .Term [UNIMOD:724] [cols="2*"] |
| id | UNIMOD:724 | name | O-Methylphosphate | def | "O-Methylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=724] | comment | Created by auto-catalytic dealkylation of the O-Dimethylphosphate adduct. | xref | record_id "724" | xref | delta_mono_mass "93.981981" | xref | delta_avge_mass "94.0065" | xref | delta_composition "H(3) C O(3) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2007-01-09 21:35:38" | xref | date_time_modified "2007-01-21 18:13:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:725] === UNIMOD:725 Diethylphosphate |
null .Term [UNIMOD:725] [cols="2*"] |
| id | UNIMOD:725 | name | Diethylphosphate | def | "O-Diethylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=725] | xref | record_id "725" | xref | delta_mono_mass "136.028931" | xref | delta_avge_mass "136.0862" | xref | delta_composition "H(9) C(4) O(3) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2007-01-09 21:44:04" | xref | date_time_modified "2011-12-05 16:15:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "K" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "C" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "H" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "N-term" | xref | spec_7_position "Any N-term" | xref | spec_7_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:726] === UNIMOD:726 Ethylphosphate |
null .Term [UNIMOD:726] [cols="2*"] |
| id | UNIMOD:726 | name | Ethylphosphate | def | "O-Ethylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=726] | comment | Created by auto-catalytic dealkylation of the O-Diethylphosphate adduct. | xref | record_id "726" | xref | delta_mono_mass "107.997631" | xref | delta_avge_mass "108.0331" | xref | delta_composition "H(5) C(2) O(3) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2007-01-09 21:46:17" | xref | date_time_modified "2011-12-05 16:15:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "K" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "N-term" | xref | spec_5_position "Any N-term" | xref | spec_5_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:727] === UNIMOD:727 O-pinacolylmethylphosphonate |
null .Term [UNIMOD:727] [cols="2*"] |
| id | UNIMOD:727 | name | O-pinacolylmethylphosphonate | def | "O-pinacolylmethylphosphonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=727] | xref | record_id "727" | xref | delta_mono_mass "162.080967" | xref | delta_avge_mass "162.1666" | xref | delta_composition "H(15) C(7) O(2) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2007-01-10 16:04:46" | xref | date_time_modified "2010-04-29 08:38:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "K" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:728] === UNIMOD:728 Methylphosphonate |
null .Term [UNIMOD:728] [cols="2*"] |
| id | UNIMOD:728 | name | Methylphosphonate | def | "Methylphosphonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=728] | comment | Created by auto-catalytic dealkylation of either the O-pinacolylmethylphosphonate adduct, or the O-isopropylmethylphosphonate adduct. | xref | record_id "728" | xref | delta_mono_mass "77.987066" | xref | delta_avge_mass "78.0071" | xref | delta_composition "H(3) C O(2) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2007-01-10 16:07:37" | xref | date_time_modified "2007-01-21 18:11:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:729] === UNIMOD:729 O-Isopropylmethylphosphonate |
null .Term [UNIMOD:729] [cols="2*"] |
| id | UNIMOD:729 | name | O-Isopropylmethylphosphonate | def | "O-Isopropylmethylphosphonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=729] | xref | record_id "729" | xref | delta_mono_mass "120.034017" | xref | delta_avge_mass "120.0868" | xref | delta_composition "H(9) C(4) O(2) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2007-01-10 16:10:55" | xref | date_time_modified "2007-01-13 21:02:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:730] === UNIMOD:730 iTRAQ8plex |
null .Term [UNIMOD:730] [cols="2*"] |
| id | UNIMOD:730 | name | iTRAQ8plex | def | "Representative mass and accurate mass for 113, 114, 116 & 117." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=730] | comment | Other 4 channels have the same nominal mass but slightly different exact mass. For quantitation purposes, use this entry for all channels. | synonym | "Applied Biosystems iTRAQ™ multiplexed quantitation chemistry AKA iTRAQ8plex:13C(7)15N(1)" [] | xref | record_id "730" | xref | delta_mono_mass "304.20536" | xref | delta_avge_mass "304.3074" | xref | delta_composition "H(24) C(7) 13C(7) N(3) 15N O(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2007-01-11 09:53:13" | xref | date_time_modified "2017-11-09 09:38:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "0" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Very low abundance" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_5_misc_notes "Very low abundance" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | xref | spec_6_misc_notes "Very low abundance" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "N-term" | xref | spec_7_position "Protein N-term" | xref | spec_7_classification "Isotopic label" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "C" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Isotopic label" | xref | spec_8_misc_notes "side reaction" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:731] === UNIMOD:731 iTRAQ8plex:13C(6)15N(2) |
null .Term [UNIMOD:731] [cols="2*"] |
| id | UNIMOD:731 | name | iTRAQ8plex:13C(6)15N(2) | def | "Accurate mass for 115, 118, 119 & 121." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=731] | comment | Other 4 channels have the same nominal mass but slightly different exact mass. For quantitation purposes, use iTRAQ8plex for all channels. | synonym | "Applied Biosystems iTRAQ™ multiplexed quantitation chemistry" [] | xref | record_id "731" | xref | delta_mono_mass "304.19904" | xref | delta_avge_mass "304.3081" | xref | delta_composition "H(24) C(8) 13C(6) N(2) 15N(2) O(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2007-01-11 09:56:21" | xref | date_time_modified "2017-11-09 09:37:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "C" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "side reaction" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:734] === UNIMOD:734 Ethanolamine |
null .Term [UNIMOD:734] [cols="2*"] |
| id | UNIMOD:734 | name | Ethanolamine | def | "Carboxyl modification with ethanolamine." [PMID:2, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=734] | comment | Carbodiimide mediated blocking of free carboxylic acids (Asp/Glu sidechains and C-termini) with ethanolamine; reaction yields an amide-bond between the carboxylic acid of the peptide/protein and the primary amine of ethanolamine; reaction irreversibly modifies carboxylic acids. Shown above is the composition of the mass adduct, after substraction of water. | xref | record_id "734" | xref | delta_mono_mass "43.042199" | xref | delta_avge_mass "43.0678" | xref | delta_composition "H(5) C(2) N" | xref | username_of_poster "overalllab" | xref | group_of_poster "" | xref | date_time_posted "2007-01-31 22:04:44" | xref | date_time_modified "2012-11-01 12:02:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "E" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "C" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:735] === UNIMOD:735 BEMAD_ST |
null .Term [UNIMOD:735] [cols="2*"] |
| id | UNIMOD:735 | name | BEMAD_ST | def | "Beta elimination of modified S or T followed by Michael addition of DTT." [PMID:15648052, PMID:17116471, PMID:12438562, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=735] | comment | Beta-elimination and Michael addition of dithiothreitol (DTT) to serine and threonine adds a weight of approximately 136.2. | synonym | "threo-1,4-dimercaptobutane-2,3-diol Was DTT_ST" [] | xref | record_id "735" | xref | delta_mono_mass "136.001656" | xref | delta_avge_mass "136.2357" | xref | delta_composition "H(8) C(4) O S(2)" | xref | username_of_poster "stephenaw777" | xref | group_of_poster "" | xref | date_time_posted "2007-02-10 00:00:43" | xref | date_time_modified "2017-06-15 14:01:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "The addition of DTT adds 136.2 not 154.2 to Serine due to loss of water in reaction" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "The addition of DTT adds 136.2 not 154.2 to Threonine due to loss of water in reaction" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:736] === UNIMOD:736 BEMAD_C |
null .Term [UNIMOD:736] [cols="2*"] |
| id | UNIMOD:736 | name | BEMAD_C | def | "Beta elimination of alkylated Cys followed by Michael addition of DTT." [PMID:12438562, PMID:17116471, PMID:16452088, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=736] | comment | When the beta-elimination and Michael addition of dithiothreitol (DTT) (BEMAD) reaction is used with alkylated cysteine a sulfur group is lost leaving the addition of approximately 120.2 in the chemical reaction. | synonym | "Was DTT_C" [] | xref | record_id "736" | xref | delta_mono_mass "120.0245" | xref | delta_avge_mass "120.1701" | xref | delta_composition "H(8) C(4) O(2) S" | xref | username_of_poster "stephenaw777" | xref | group_of_poster "" | xref | date_time_posted "2007-02-10 03:12:41" | xref | date_time_modified "2017-06-15 13:58:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:737] === UNIMOD:737 TMT6plex |
null .Term [UNIMOD:737] [cols="2*"] |
| id | UNIMOD:737 | name | TMT6plex | def | "Sixplex Tandem Mass Tag®." [URL:https\://www.piercenet.com/instructions/2162073.pdf, URL:http\://www.piercenet.com/instructions/2162457.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=737] | comment | M/z values of the TMT® fragment ions to be quantified for 6plex and 10plex: 126.12773 127.12476 128.13443 129.13147 130.14114 131.13818. Additional m/z values for 10plex: 127.13108 128.12811 129.13779 130.13482. | synonym | "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc. Also applies to TMT10plex Tandem Mass Tag sixplex labelling kit Proteome Sciences This is a nominal. representative mass" [] | xref | record_id "737" | xref | delta_mono_mass "229.162932" | xref | delta_avge_mass "229.2634" | xref | delta_composition "H(20) C(8) 13C(4) N 15N O(2)" | xref | username_of_poster "JUergen.schaefer" | xref | group_of_poster "" | xref | date_time_posted "2007-03-01 13:44:23" | xref | date_time_modified "2014-11-08 15:20:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:738] === UNIMOD:738 TMT2plex |
null .Term [UNIMOD:738] [cols="2*"] |
| id | UNIMOD:738 | name | TMT2plex | def | "Duplex Tandem Mass Tag®." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=738] | comment | Duplex-TMT® reagents 2TMT-126, 2TMT-127. m/z values of the TMT® fragment ions to be quantified: 126.12773 127.13108. | synonym | "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc. Tandem Mass Tag Duplex labelling kit Proteome Sciences" [] | xref | record_id "738" | xref | delta_mono_mass "225.155833" | xref | delta_avge_mass "225.2921" | xref | delta_composition "H(20) C(11) 13C N(2) O(2)" | xref | username_of_poster "JUergen.schaefer" | xref | group_of_poster "" | xref | date_time_posted "2007-03-01 13:53:36" | xref | date_time_modified "2014-11-08 15:19:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:739] === UNIMOD:739 TMT |
null .Term [UNIMOD:739] [cols="2*"] |
| id | UNIMOD:739 | name | TMT | def | "Native Tandem Mass Tag®." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=739] | comment | This modification describes the \"native\" TMT Reagent without isotopic label. | synonym | "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] | xref | record_id "739" | xref | delta_mono_mass "224.152478" | xref | delta_avge_mass "224.2994" | xref | delta_composition "H(20) C(12) N(2) O(2)" | xref | username_of_poster "JUergen.schaefer" | xref | group_of_poster "" | xref | date_time_posted "2007-03-02 09:29:50" | xref | date_time_modified "2011-11-25 11:15:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:740] === UNIMOD:740 ExacTagThiol |
null .Term [UNIMOD:740] [cols="2*"] |
| id | UNIMOD:740 | name | ExacTagThiol | def | "ExacTag Thiol label mass for 2-4-7-10 plex." [URL:http\://www.perkinelmer.com/exactag, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=740] | comment | Accurate mass for Exactag Thiol labels. | synonym | "PerkinElmer ExacTag Thiol kit" [] | xref | record_id "740" | xref | delta_mono_mass "972.365219" | xref | delta_avge_mass "972.7268" | xref | delta_composition "H(50) C(23) 13C(12) N(8) 15N(6) O(18)" | xref | username_of_poster "cparman" | xref | group_of_poster "" | xref | date_time_posted "2007-03-02 17:24:48" | xref | date_time_modified "2017-10-09 15:48:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:741] === UNIMOD:741 ExacTagAmine |
null .Term [UNIMOD:741] [cols="2*"] |
| id | UNIMOD:741 | name | ExacTagAmine | def | "ExacTag Amine label mass for 2-4-7-10 plex." [URL:http\://www.perkinelmer.com/exactag, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=741] | comment | Accurate mass for Exactag Amine labels. Includes the mass of the conjugation reagent. | synonym | "PerkinElmer ExacTag Amine kit" [] | xref | record_id "741" | xref | delta_mono_mass "1046.347854" | xref | delta_avge_mass "1046.8285" | xref | delta_composition "H(52) C(25) 13C(12) N(8) 15N(6) O(19) S" | xref | username_of_poster "cparman" | xref | group_of_poster "" | xref | date_time_posted "2007-03-02 17:28:02" | xref | date_time_modified "2017-10-09 15:48:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:743] === UNIMOD:743 4-ONE+Delta:H(-2)O(-1) |
null .Term [UNIMOD:743] [cols="2*"] |
| id | UNIMOD:743 | name | 4-ONE+Delta:H(-2)O(-1) | def | "Dehydrated 4-Oxononenal Michael adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=743] | comment | Mass Spectorscopic Characterization of Protein Modification by 4-hydroxy-2-(E)-nonenal and 4-oxo-2-(E)-nonenal. | xref | record_id "743" | xref | delta_mono_mass "136.088815" | xref | delta_avge_mass "136.191" | xref | delta_composition "H(12) C(9) O" | xref | username_of_poster "stewartb" | xref | group_of_poster "" | xref | date_time_posted "2007-03-21 21:21:34" | xref | date_time_modified "2007-04-08 18:56:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:744] === UNIMOD:744 NO_SMX_SEMD |
null .Term [UNIMOD:744] [cols="2*"] |
| id | UNIMOD:744 | name | NO_SMX_SEMD | def | "Nitroso Sulfamethoxazole Sulphenamide thiol adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=744] | comment | Synthesis and Reactions of Nitroso Sulphamethoxazole with Biological Nucleophiles: Implications for Immune Mediated Toxicity. | xref | record_id "744" | xref | delta_mono_mass "252.044287" | xref | delta_avge_mass "252.2697" | xref | delta_composition "H(10) C(10) N(3) O(3) S" | xref | username_of_poster "stewartb" | xref | group_of_poster "" | xref | date_time_posted "2007-04-17 23:28:29" | xref | date_time_modified "2007-04-21 16:55:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:745] === UNIMOD:745 NO_SMX_SMCT |
null .Term [UNIMOD:745] [cols="2*"] |
| id | UNIMOD:745 | name | NO_SMX_SMCT | def | "Nitroso Sulfamethoxazole semimercaptal thiol adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=745] | comment | Synthesis and Reactions of Nitroso Sulphamethoxazole with Biological Nucleophiles: Implications for Immune Mediated Toxicity. | xref | record_id "745" | xref | delta_mono_mass "268.039202" | xref | delta_avge_mass "268.2691" | xref | delta_composition "H(10) C(10) N(3) O(4) S" | xref | username_of_poster "stewartb" | xref | group_of_poster "" | xref | date_time_posted "2007-04-18 21:37:48" | xref | date_time_modified "2007-04-21 16:56:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:746] === UNIMOD:746 NO_SMX_SIMD |
null .Term [UNIMOD:746] [cols="2*"] |
| id | UNIMOD:746 | name | NO_SMX_SIMD | def | "Nitroso Sulfamethoxazole Sulfinamide thiol adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=746] | comment | Synthesis and Reactions of Nitroso Sulphamethoxazole with Biological Nucleophiles: Implications for Immune Mediated Toxicity. | xref | record_id "746" | xref | delta_mono_mass "267.031377" | xref | delta_avge_mass "267.2612" | xref | delta_composition "H(9) C(10) N(3) O(4) S" | xref | username_of_poster "stewartb" | xref | group_of_poster "" | xref | date_time_posted "2007-04-18 21:39:11" | xref | date_time_modified "2007-04-21 16:56:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:747] === UNIMOD:747 Malonyl |
null .Term [UNIMOD:747] [cols="2*"] |
| id | UNIMOD:747 | name | Malonyl | def | "Malonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=747] | xref | record_id "747" | xref | delta_mono_mass "86.000394" | xref | delta_avge_mass "86.0462" | xref | delta_composition "H(2) C(3) O(3)" | xref | username_of_poster "massy" | xref | group_of_poster "" | xref | date_time_posted "2007-05-17 14:17:42" | xref | date_time_modified "2017-04-03 10:51:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:748] === UNIMOD:748 3sulfo |
null .Term [UNIMOD:748] [cols="2*"] |
| id | UNIMOD:748 | name | 3sulfo | def | "Derivatization by N-term modification using 3-Sulfobenzoic succinimidyl ester." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=748] | xref | record_id "748" | xref | delta_mono_mass "183.983029" | xref | delta_avge_mass "184.1693" | xref | delta_composition "H(4) C(7) O(4) S" | xref | username_of_poster "MaxWis" | xref | group_of_poster "" | xref | date_time_posted "2007-05-31 10:15:48" | xref | date_time_modified "2007-06-24 19:58:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:750] === UNIMOD:750 trifluoro |
null .Term [UNIMOD:750] [cols="2*"] |
| id | UNIMOD:750 | name | trifluoro | def | "Trifluoroleucine replacement of leucine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=750] | xref | record_id "750" | xref | delta_mono_mass "53.971735" | xref | delta_avge_mass "53.9714" | xref | delta_composition "H(-3) F(3)" | xref | username_of_poster "UKMSF" | xref | group_of_poster "" | xref | date_time_posted "2007-06-13 17:10:33" | xref | date_time_modified "2007-06-24 19:56:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Non-standard residue" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:751] === UNIMOD:751 TNBS |
null .Term [UNIMOD:751] [cols="2*"] |
| id | UNIMOD:751 | name | TNBS | def | "Tri nitro benzene." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=751] | xref | record_id "751" | xref | delta_mono_mass "210.986535" | xref | delta_avge_mass "211.0886" | xref | delta_composition "H C(6) N(3) O(6)" | xref | username_of_poster "DelphineP" | xref | group_of_poster "" | xref | date_time_posted "2007-06-21 13:36:03" | xref | date_time_modified "2007-06-24 19:58:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:762] === UNIMOD:762 IDEnT |
null .Term [UNIMOD:762] [cols="2*"] |
| id | UNIMOD:762 | name | IDEnT | def | "Isotope Distribution Encoded Tag." [PMID:10740847, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=762] | comment | Modified peptides identified by isotope pattern. Restriction to cysteine-containing peptides combined with high mass accuracy allows peptide identification. | synonym | "2,4-dichlorobenzylcarbamidomethyl" [] | xref | record_id "762" | xref | delta_mono_mass "214.990469" | xref | delta_avge_mass "216.064" | xref | delta_composition "H(7) C(9) N O Cl(2)" | xref | username_of_poster "chalkley" | xref | group_of_poster "" | xref | date_time_posted "2007-07-10 20:14:50" | xref | date_time_modified "2007-07-15 20:04:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:763] === UNIMOD:763 BEMAD_ST:2H(6) |
null .Term [UNIMOD:763] [cols="2*"] |
| id | UNIMOD:763 | name | BEMAD_ST:2H(6) | def | "Beta elimination of modified S or T followed by Michael addition of labelled DTT." [PMID:15648052, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=763] | comment | Can be used for quantitative analysis of O-linked post-translational modifications. Same reaction can be used for quantitative analysis of cysteine-containing peptides, but then the modification is 16 Da less in mass; i.e. isotopically labeled reagent adds 126 Da in mass. | synonym | "Was DTT_ST:2H(6)" [] | xref | record_id "763" | xref | delta_mono_mass "142.039317" | xref | delta_avge_mass "142.2727" | xref | delta_composition "H(2) 2H(6) C(4) O S(2)" | xref | username_of_poster "chalkley" | xref | group_of_poster "" | xref | date_time_posted "2007-07-10 20:34:46" | xref | date_time_modified "2017-06-15 14:01:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:764] === UNIMOD:764 BEMAD_C:2H(6) |
null .Term [UNIMOD:764] [cols="2*"] |
| id | UNIMOD:764 | name | BEMAD_C:2H(6) | def | "Beta elimination of alkylated Cys followed by Michael addition of labelled DTT." [PMID:15648052, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=764] | comment | Can be used for quantitative analysis of cysteine-containing peptides. Same reaction can be used for quantitative analysis of O-linked post-translational modifications to serines and threonines, but then the modification is 16 Da more in mass; i.e. isotopically labeled reagent adds 142 Da in mass. | synonym | "Was DTT_C:2H(6) Isotopically labeled Dithiothreitol (DTT) modification of cysteines" [] | xref | record_id "764" | xref | delta_mono_mass "126.062161" | xref | delta_avge_mass "126.2071" | xref | delta_composition "H(2) 2H(6) C(4) O(2) S" | xref | username_of_poster "chalkley" | xref | group_of_poster "" | xref | date_time_posted "2007-07-10 20:44:56" | xref | date_time_modified "2017-06-15 13:59:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:765] === UNIMOD:765 Met-loss |
null .Term [UNIMOD:765] [cols="2*"] |
| id | UNIMOD:765 | name | Met-loss | def | "Removal of initiator methionine from protein N-terminus." [PMID:3327521, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=765] | comment | N-terminal initiator methionine is removed by a methionine aminopeptidase from proteins where the residue following the methionine is Ala, Cys, Gly, Pro, Ser, Thr or Val. This is generally the final N-terminal state for proteins where the following residue was a Cys, Pro or Val. | xref | record_id "765" | xref | delta_mono_mass "-131.040485" | xref | delta_avge_mass "-131.1961" | xref | delta_composition "H(-9) C(-5) N(-1) O(-1) S(-1)" | xref | username_of_poster "chalkley" | xref | group_of_poster "" | xref | date_time_posted "2007-07-10 22:40:00" | xref | date_time_modified "2007-07-15 20:01:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Co-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:766] === UNIMOD:766 Met-loss+Acetyl |
null .Term [UNIMOD:766] [cols="2*"] |
| id | UNIMOD:766 | name | Met-loss+Acetyl | def | "Removal of initiator methionine from protein N-terminus, then acetylation of the new N-terminus." [PMID:3327521, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=766] | comment | The N-terminal initiator methionine is removed by a methionine aminopeptidase from proteins whose residue following the methionine is Ala, Cys, Gly, Pro, Ser, Thr or Val. Proteins whose following residue was Ala, Gly, Ser or Thr are then acetylated by an N(alpha)-acetyltransferase on the new N-terminus. | xref | record_id "766" | xref | delta_mono_mass "-89.02992" | xref | delta_avge_mass "-89.1594" | xref | delta_composition "H(-7) C(-3) N(-1) S(-1)" | xref | username_of_poster "chalkley" | xref | group_of_poster "" | xref | date_time_posted "2007-07-10 22:57:12" | xref | date_time_modified "2007-07-15 20:01:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Protein N-term" | xref | spec_1_classification "Co-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:767] === UNIMOD:767 Menadione-HQ |
null .Term [UNIMOD:767] [cols="2*"] |
| id | UNIMOD:767 | name | Menadione-HQ | def | "Menadione hydroquinone derivative." [PMID:15939799, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=767] | xref | record_id "767" | xref | delta_mono_mass "172.05243" | xref | delta_avge_mass "172.18" | xref | delta_composition "H(8) C(11) O(2)" | xref | username_of_poster "catsriku" | xref | group_of_poster "" | xref | date_time_posted "2007-07-12 07:35:07" | xref | date_time_modified "2007-07-15 20:05:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:768] === UNIMOD:768 Methyl+Acetyl:2H(3) |
null .Term [UNIMOD:768] [cols="2*"] |
| id | UNIMOD:768 | name | Methyl+Acetyl:2H(3) | def | "Mono-methylated lysine labelled with Acetyl_heavy." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=768] | xref | record_id "768" | xref | delta_mono_mass "59.045045" | xref | delta_avge_mass "59.0817" | xref | delta_composition "H 2H(3) C(3) O" | xref | username_of_poster "buchanan" | xref | group_of_poster "" | xref | date_time_posted "2007-08-06 09:35:40" | xref | date_time_modified "2007-09-07 16:56:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:771] === UNIMOD:771 lapachenole |
null .Term [UNIMOD:771] [cols="2*"] |
| id | UNIMOD:771 | name | lapachenole | def | "Lapachenole photochemically added to cysteine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=771] | xref | record_id "771" | xref | delta_mono_mass "240.11503" | xref | delta_avge_mass "240.297" | xref | delta_composition "H(16) C(16) O(2)" | xref | username_of_poster "hmfales" | xref | group_of_poster "" | xref | date_time_posted "2007-08-17 22:22:15" | xref | date_time_modified "2007-09-07 16:52:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "Simple cyclic compound C16H16O2 adds to cysteine forming fluorescent derivative." | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:772] === UNIMOD:772 Label:13C(5) |
null .Term [UNIMOD:772] [cols="2*"] |
| id | UNIMOD:772 | name | Label:13C(5) | def | "13C(5) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=772] | xref | record_id "772" | xref | delta_mono_mass "5.016774" | xref | delta_avge_mass "4.9633" | xref | delta_composition "C(-5) 13C(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2007-08-22 18:36:11" | xref | date_time_modified "2007-08-22 18:36:11" | xref | approved "1" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Result of Arg to Pro conversion of 13C(6) labelled Arg" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:773] === UNIMOD:773 maleimide |
null .Term [UNIMOD:773] [cols="2*"] |
| id | UNIMOD:773 | name | maleimide | def | "Maleimide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=773] | xref | record_id "773" | xref | delta_mono_mass "97.016378" | xref | delta_avge_mass "97.0721" | xref | delta_composition "H(3) C(4) N O(2)" | xref | username_of_poster "mjayson" | xref | group_of_poster "" | xref | date_time_posted "2007-09-05 23:31:52" | xref | date_time_modified "2007-09-06 11:28:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:774] === UNIMOD:774 Biotin-phenacyl |
null .Term [UNIMOD:774] [cols="2*"] |
| id | UNIMOD:774 | name | Biotin-phenacyl | def | "Alkylation by biotinylated form of phenacyl bromide." [PMID:428399, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=774] | comment | Phenacyl bromide conjugated with a linker and biotin tag, details not published yet. | xref | record_id "774" | xref | delta_mono_mass "626.263502" | xref | delta_avge_mass "626.727" | xref | delta_composition "H(38) C(29) N(8) O(6) S" | xref | username_of_poster "Sandeep" | xref | group_of_poster "" | xref | date_time_posted "2007-09-14 23:07:12" | xref | date_time_modified "2007-10-03 15:42:46" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "S" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:775] === UNIMOD:775 Carboxymethyl:13C(2) |
null .Term [UNIMOD:775] [cols="2*"] |
| id | UNIMOD:775 | name | Carboxymethyl:13C(2) | def | "Iodoacetic acid derivative w/ 13C label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=775] | synonym | "Carboxymethylation w/ 13C label" [] | xref | record_id "775" | xref | delta_mono_mass "60.012189" | xref | delta_avge_mass "60.0214" | xref | delta_composition "H(2) 13C(2) O(2)" | xref | username_of_poster "mpcusack" | xref | group_of_poster "" | xref | date_time_posted "2007-09-18 19:26:42" | xref | date_time_modified "2008-06-22 12:00:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:776] === UNIMOD:776 NEM:2H(5) |
null .Term [UNIMOD:776] [cols="2*"] |
| id | UNIMOD:776 | name | NEM:2H(5) | def | "D5 N-ethylmaleimide on cysteines." [URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:12777388, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=776] | synonym | "CysNEM D5" [] | xref | record_id "776" | xref | delta_mono_mass "130.079062" | xref | delta_avge_mass "130.1561" | xref | delta_composition "H(2) 2H(5) C(6) N O(2)" | xref | username_of_poster "mpcusack" | xref | group_of_poster "" | xref | date_time_posted "2007-09-18 19:49:39" | xref | date_time_modified "2007-09-28 10:37:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:792] === UNIMOD:792 AEC-MAEC:2H(4) |
null .Term [UNIMOD:792] [cols="2*"] |
| id | UNIMOD:792 | name | AEC-MAEC:2H(4) | def | "Deuterium cysteamine modification to S or T." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=792] | xref | record_id "792" | xref | delta_mono_mass "63.044462" | xref | delta_avge_mass "63.158" | xref | delta_composition "H 2H(4) C(2) N O(-1) S" | xref | username_of_poster "zwang23" | xref | group_of_poster "" | xref | date_time_posted "2007-10-03 19:41:19" | xref | date_time_modified "2007-10-08 13:44:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:793] === UNIMOD:793 Hex(1)HexNAc(1) |
null .Term [UNIMOD:793] [cols="2*"] |
| id | UNIMOD:793 | name | Hex(1)HexNAc(1) | def | "Hex1HexNAc1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=793] | xref | record_id "793" | xref | delta_mono_mass "365.132196" | xref | delta_avge_mass "365.3331" | xref | delta_composition "Hex HexNAc" | xref | username_of_poster "julienjardin" | xref | group_of_poster "" | xref | date_time_posted "2007-10-12 13:16:23" | xref | date_time_modified "2017-11-23 13:04:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_366_mono_mass "365.132196" | xref | spec_1_neutral_loss_366_avge_mass "365.3331" | xref | spec_1_neutral_loss_366_flag "false" | xref | spec_1_neutral_loss_366_composition "Hex HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_366_mono_mass "365.132196" | xref | spec_1_neutral_loss_366_avge_mass "365.3331" | xref | spec_1_neutral_loss_366_flag "false" | xref | spec_1_neutral_loss_366_composition "Hex HexNAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_misc_notes "Not reported for human proteins" | xref | spec_2_neutral_loss_366_mono_mass "365.132196" | xref | spec_2_neutral_loss_366_avge_mass "365.3331" | xref | spec_2_neutral_loss_366_flag "false" | xref | spec_2_neutral_loss_366_composition "Hex HexNAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:799] === UNIMOD:799 Label:13C(6)+GG |
null .Term [UNIMOD:799] [cols="2*"] |
| id | UNIMOD:799 | name | Label:13C(6)+GG | def | "13C6 labeled ubiquitinylation residue." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=799] | comment | The two glycine residues left on SILAC labeled ubiquitinylated lysine after tryptic digestion. | xref | record_id "799" | xref | delta_mono_mass "120.063056" | xref | delta_avge_mass "120.0586" | xref | delta_composition "H(6) C(-2) 13C(6) N(2) O(2)" | xref | username_of_poster "glick2" | xref | group_of_poster "" | xref | date_time_posted "2007-12-02 22:45:39" | xref | date_time_modified "2014-07-09 16:53:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:800] === UNIMOD:800 Biotin:Thermo-21345 |
null .Term [UNIMOD:800] [cols="2*"] |
| id | UNIMOD:800 | name | Biotin:Thermo-21345 | def | "Was PentylamineBiotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031206, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=800] | synonym | "Used for labeling glutamine-donor substrate of transglutaminase" [] | xref | record_id "800" | xref | delta_mono_mass "311.166748" | xref | delta_avge_mass "311.4429" | xref | delta_composition "H(25) C(15) N(3) O(2) S" | xref | username_of_poster "mengyi" | xref | group_of_poster "" | xref | date_time_posted "2007-12-03 13:56:58" | xref | date_time_modified "2015-01-21 09:40:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:801] === UNIMOD:801 Pentylamine |
null .Term [UNIMOD:801] [cols="2*"] |
| id | UNIMOD:801 | name | Pentylamine | def | "Labeling transglutaminase substrate on glutamine side chain." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=801] | xref | record_id "801" | xref | delta_mono_mass "85.089149" | xref | delta_avge_mass "85.1475" | xref | delta_composition "H(11) C(5) N" | xref | username_of_poster "mengyi" | xref | group_of_poster "" | xref | date_time_posted "2007-12-05 11:08:02" | xref | date_time_modified "2007-12-14 17:52:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:811] === UNIMOD:811 Biotin:Thermo-21360 |
null .Term [UNIMOD:811] [cols="2*"] |
| id | UNIMOD:811 | name | Biotin:Thermo-21360 | def | "Was Biotin-PEO4-hydrazide." [URL:http\://www.piercenet.com/products/browse.cfm?fldID=C4FE82D4-DD06-493C-8EC4-9C1D7F83211B, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=811] | synonym | "Pierce EZ link biotin hydrazide prod no. 21360" [] | xref | record_id "811" | xref | delta_mono_mass "487.246455" | xref | delta_avge_mass "487.6134" | xref | delta_composition "H(37) C(21) N(5) O(6) S" | xref | username_of_poster "MCole18" | xref | group_of_poster "" | xref | date_time_posted "2007-12-12 15:23:23" | xref | date_time_modified "2010-12-03 16:05:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "hydrazide reacts at any activated carboxyl group" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:821] === UNIMOD:821 Cy3b-maleimide |
null .Term [UNIMOD:821] [cols="2*"] |
| id | UNIMOD:821 | name | Cy3b-maleimide | def | "Fluorescent dye that labels cysteines." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=821] | synonym | "Cy3b meleimide reacted with Cysteine Formula requires confirmation" [] | xref | record_id "821" | xref | delta_mono_mass "682.24612" | xref | delta_avge_mass "682.7852" | xref | delta_composition "H(38) C(37) N(4) O(7) S" | xref | username_of_poster "kfinan" | xref | group_of_poster "" | xref | date_time_posted "2008-02-01 16:03:09" | xref | date_time_modified "2012-09-14 23:51:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:822] === UNIMOD:822 Gly-loss+Amide |
null .Term [UNIMOD:822] [cols="2*"] |
| id | UNIMOD:822 | name | Gly-loss+Amide | def | "Enzymatic glycine removal leaving an amidated C-terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=822] | synonym | "Amidation requires presence of glycine at peptide terminus" [] | xref | record_id "822" | xref | delta_mono_mass "-58.005479" | xref | delta_avge_mass "-58.0361" | xref | delta_composition "H(-2) C(-2) O(-2)" | xref | username_of_poster "timothyr" | xref | group_of_poster "" | xref | date_time_posted "2008-02-06 09:33:39" | xref | date_time_modified "2010-07-14 23:15:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:824] === UNIMOD:824 Xlink:BMOE |
null .Term [UNIMOD:824] [cols="2*"] |
| id | UNIMOD:824 | name | Xlink:BMOE | def | "Intact or monolink BMOE crosslinker." [URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011308_Bismaleimide_CrsLnk_BMOE_BMB_BMH_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=824] | xref | record_id "824" | xref | delta_mono_mass "220.048407" | xref | delta_avge_mass "220.1815" | xref | delta_composition "H(8) C(10) N(2) O(4)" | xref | username_of_poster "Larsenmarsen" | xref | group_of_poster "" | xref | date_time_posted "2008-02-13 15:28:55" | xref | date_time_modified "2017-08-18 11:12:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:825] === UNIMOD:825 Xlink:DFDNB |
null .Term [UNIMOD:825] [cols="2*"] |
| id | UNIMOD:825 | name | Xlink:DFDNB | def | "Intact DFDNB crosslinker." [URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011313_DFDNB_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=825] | xref | record_id "825" | xref | delta_mono_mass "163.985807" | xref | delta_avge_mass "164.0752" | xref | delta_composition "C(6) N(2) O(4)" | xref | username_of_poster "Larsenmarsen" | xref | group_of_poster "" | xref | date_time_posted "2008-02-13 15:35:40" | xref | date_time_modified "2017-08-18 11:55:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Q" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:827] === UNIMOD:827 TMPP-Ac |
null .Term [UNIMOD:827] [cols="2*"] |
| id | UNIMOD:827 | name | TMPP-Ac | def | "Tris(2,4,6-trimethoxyphenyl)phosphonium acetic acid N-hydroxysuccinimide ester derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=827] | comment | The formula has been reduced from H(34) to H(33) on 13 May 2009 so as to give correct observed m/z values. The charge on the TMPP means that ions have one less proton than would be expected. | xref | record_id "827" | xref | delta_mono_mass "572.181134" | xref | delta_avge_mass "572.5401" | xref | delta_composition "H(33) C(29) O(10) P" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2008-02-20 14:12:31" | xref | date_time_modified "2018-06-26 15:22:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:830] === UNIMOD:830 Dihydroxyimidazolidine |
null .Term [UNIMOD:830] [cols="2*"] |
| id | UNIMOD:830 | name | Dihydroxyimidazolidine | def | "Dihydroxy methylglyoxal adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=830] | xref | record_id "830" | xref | delta_mono_mass "72.021129" | xref | delta_avge_mass "72.0627" | xref | delta_composition "H(4) C(3) O(2)" | xref | username_of_poster "kimzey" | xref | group_of_poster "" | xref | date_time_posted "2008-03-04 00:00:29" | xref | date_time_modified "2008-05-22 00:32:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:834] === UNIMOD:834 Label:2H(4)+Acetyl |
null .Term [UNIMOD:834] [cols="2*"] |
| id | UNIMOD:834 | name | Label:2H(4)+Acetyl | def | "Acetyl 4,4,5,5-D4 Lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=834] | comment | For SILAC experiments, + PTM. | synonym | "Acetyl_K4" [] | xref | record_id "834" | xref | delta_mono_mass "46.035672" | xref | delta_avge_mass "46.0613" | xref | delta_composition "H(-2) 2H(4) C(2) O" | xref | username_of_poster "Raghothama" | xref | group_of_poster "" | xref | date_time_posted "2008-03-24 17:25:15" | xref | date_time_modified "2008-04-02 10:17:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Both isotopiclabel and post translational mod" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:835] === UNIMOD:835 Label:13C(6)+Acetyl |
null .Term [UNIMOD:835] [cols="2*"] |
| id | UNIMOD:835 | name | Label:13C(6)+Acetyl | def | "Acetyl 13C(6) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=835] | xref | record_id "835" | xref | delta_mono_mass "48.030694" | xref | delta_avge_mass "47.9926" | xref | delta_composition "H(2) C(-4) 13C(6) O" | xref | username_of_poster "Raghothama" | xref | group_of_poster "" | xref | date_time_posted "2008-03-24 17:33:44" | xref | date_time_modified "2008-04-02 10:14:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "SILAC and PTM" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:836] === UNIMOD:836 Label:13C(6)15N(2)+Acetyl |
null .Term [UNIMOD:836] [cols="2*"] |
| id | UNIMOD:836 | name | Label:13C(6)15N(2)+Acetyl | def | "Acetyl_13C(6) 15N(2) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=836] | synonym | "Acetyl_heavy lysine" [] | xref | record_id "836" | xref | delta_mono_mass "50.024764" | xref | delta_avge_mass "49.9794" | xref | delta_composition "H(2) C(-4) 13C(6) N(-2) 15N(2) O" | xref | username_of_poster "Raghothama" | xref | group_of_poster "" | xref | date_time_posted "2008-03-24 17:35:52" | xref | date_time_modified "2008-04-02 10:13:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in SILAC experiment" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:837] === UNIMOD:837 Arg→Npo |
null .Term [UNIMOD:837] [cols="2*"] |
| id | UNIMOD:837 | name | Arg→Npo | def | "Arginine replacement by Nitropyrimidyl ornithine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=837] | xref | record_id "837" | xref | delta_mono_mass "80.985078" | xref | delta_avge_mass "81.0297" | xref | delta_composition "H(-1) C(3) N O(2)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2008-04-10 15:35:22" | xref | date_time_modified "2008-04-21 18:30:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:846] === UNIMOD:846 EQIGG |
null .Term [UNIMOD:846] [cols="2*"] |
| id | UNIMOD:846 | name | EQIGG | def | "Sumo mutant Smt3-WT tail following trypsin digestion." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=846] | synonym | "Sumoylation" [] | xref | record_id "846" | xref | delta_mono_mass "484.228162" | xref | delta_avge_mass "484.5035" | xref | delta_composition "H(32) C(20) N(6) O(8)" | xref | username_of_poster "Magnojunqueira" | xref | group_of_poster "" | xref | date_time_posted "2008-05-13 16:56:23" | xref | date_time_modified "2008-05-17 18:58:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:848] === UNIMOD:848 Arg2PG |
null .Term [UNIMOD:848] [cols="2*"] |
| id | UNIMOD:848 | name | Arg2PG | def | "Adduct of phenylglyoxal with Arg." [PMID:11945751, PMID:11698400, PMID:5723461, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=848] | xref | record_id "848" | xref | delta_mono_mass "266.057909" | xref | delta_avge_mass "266.2482" | xref | delta_composition "H(10) C(16) O(4)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2008-05-16 11:07:51" | xref | date_time_modified "2008-11-21 18:13:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "The reaction product of Arg with phenylglyoxal has been shown to be a 2:1 adduct" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:849] === UNIMOD:849 cGMP |
null .Term [UNIMOD:849] [cols="2*"] |
| id | UNIMOD:849 | name | cGMP | def | "S-guanylation." [PMID:17906641, PMID:15063129, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=849] | comment | Protein which is posttranslationally modified by the attachment of cGMP on the sulfur atom of Cys or hydroxyl group of Ser residues. | xref | record_id "849" | xref | delta_mono_mass "343.031785" | xref | delta_avge_mass "343.1895" | xref | delta_composition "H(10) C(10) N(5) O(7) P" | xref | username_of_poster "atsushiirie" | xref | group_of_poster "" | xref | date_time_posted "2008-06-21 09:02:53" | xref | date_time_modified "2014-02-08 02:24:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:851] === UNIMOD:851 cGMP+RMP-loss |
null .Term [UNIMOD:851] [cols="2*"] |
| id | UNIMOD:851 | name | cGMP+RMP-loss | def | "S-guanylation-2." [PMID:17906641, PMID:15063129, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=851] | comment | Protein which is posttranslationally modified by the attachment of cGMP that has lost ribose 3\',5\'-cyclic monophosphate moiety on the sulfur atom of Cys or hydroxyl group of Ser. | xref | record_id "851" | xref | delta_mono_mass "150.041585" | xref | delta_avge_mass "150.1182" | xref | delta_composition "H(4) C(5) N(5) O" | xref | username_of_poster "atsushiirie" | xref | group_of_poster "" | xref | date_time_posted "2008-06-21 09:06:56" | xref | date_time_modified "2009-05-24 20:03:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:853] === UNIMOD:853 Label:2H(4)+GG |
null .Term [UNIMOD:853] [cols="2*"] |
| id | UNIMOD:853 | name | Label:2H(4)+GG | def | "Ubiquitination 2H4 lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=853] | xref | record_id "853" | xref | delta_mono_mass "118.068034" | xref | delta_avge_mass "118.1273" | xref | delta_composition "H(2) 2H(4) C(4) N(2) O(2)" | xref | username_of_poster "Raghothama" | xref | group_of_poster "" | xref | date_time_posted "2008-06-27 14:28:36" | xref | date_time_modified "2014-07-09 16:52:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:859] === UNIMOD:859 MG-H1 |
null .Term [UNIMOD:859] [cols="2*"] |
| id | UNIMOD:859 | name | MG-H1 | def | "Methylglyoxal-derived hydroimidazolone." [PMID:15377717, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=859] | xref | record_id "859" | xref | delta_mono_mass "54.010565" | xref | delta_avge_mass "54.0474" | xref | delta_composition "H(2) C(3) O" | xref | username_of_poster "AndrewW" | xref | group_of_poster "" | xref | date_time_posted "2008-07-24 14:41:07" | xref | date_time_modified "2008-07-31 17:14:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:860] === UNIMOD:860 G-H1 |
null .Term [UNIMOD:860] [cols="2*"] |
| id | UNIMOD:860 | name | G-H1 | def | "Glyoxal-derived hydroimiadazolone." [PMID:17143934, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=860] | xref | record_id "860" | xref | delta_mono_mass "39.994915" | xref | delta_avge_mass "40.0208" | xref | delta_composition "C(2) O" | xref | username_of_poster "AndrewW" | xref | group_of_poster "" | xref | date_time_posted "2008-07-24 14:44:11" | xref | date_time_modified "2008-07-31 17:16:39" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:861] === UNIMOD:861 ZGB |
null .Term [UNIMOD:861] [cols="2*"] |
| id | UNIMOD:861 | name | ZGB | def | "NHS ester linked Green Fluorescent Bodipy Dye." [URL:http\://www.zdye.com/, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=861] | xref | record_id "861" | xref | delta_mono_mass "758.380841" | xref | delta_avge_mass "758.7261" | xref | delta_composition "H(53) B C(37) N(6) O(6) F(2) S" | xref | username_of_poster "JBowden" | xref | group_of_poster "" | xref | date_time_posted "2008-07-30 14:51:06" | xref | date_time_modified "2008-09-22 21:42:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:862] === UNIMOD:862 Label:13C(1)2H(3) |
null .Term [UNIMOD:862] [cols="2*"] |
| id | UNIMOD:862 | name | Label:13C(1)2H(3) | def | "SILAC." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=862] | xref | record_id "862" | xref | delta_mono_mass "4.022185" | xref | delta_avge_mass "4.0111" | xref | delta_composition "H(-3) 2H(3) C(-1) 13C" | xref | username_of_poster "msalek" | xref | group_of_poster "" | xref | date_time_posted "2008-08-11 13:43:25" | xref | date_time_modified "2008-08-14 18:16:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Isotopic labeled methionine SILAC" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:864] === UNIMOD:864 Label:13C(6)15N(2)+GG |
null .Term [UNIMOD:864] [cols="2*"] |
| id | UNIMOD:864 | name | Label:13C(6)15N(2)+GG | def | "13C(6) 15N(2) Lysine glygly." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=864] | synonym | "heavy glygly lysine" [] | xref | record_id "864" | xref | delta_mono_mass "122.057126" | xref | delta_avge_mass "122.0454" | xref | delta_composition "H(6) C(-2) 13C(6) 15N(2) O(2)" | xref | username_of_poster "Raghothama" | xref | group_of_poster "" | xref | date_time_posted "2008-08-13 21:56:52" | xref | date_time_modified "2014-07-09 16:53:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in SILAC PTM (glygly) experiment" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:866] === UNIMOD:866 ICPL:13C(6)2H(4) |
null .Term [UNIMOD:866] [cols="2*"] |
| id | UNIMOD:866 | name | ICPL:13C(6)2H(4) | def | "Bruker Daltonics SERVA-ICPL™ quantification chemistry, +10 Da form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=866] | comment | Attention: As the digest is typically applied AFTER ICPL labeling, only ProteinN-term labeling and Lys-specific labeling is applied. | synonym | "ICPL_10" [] | xref | record_id "866" | xref | delta_mono_mass "115.0667" | xref | delta_avge_mass "115.0747" | xref | delta_composition "H(-1) 2H(4) 13C(6) N O" | xref | username_of_poster "suckau" | xref | group_of_poster "" | xref | date_time_posted "2008-09-03 15:17:21" | xref | date_time_modified "2008-09-12 11:59:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_2_misc_notes "Use when labelling pre-digest" | xref | spec_3_group "3" | xref | spec_3_hidden "0" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Use when labelling post-digest" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:876] === UNIMOD:876 QEQTGG |
null .Term [UNIMOD:876] [cols="2*"] |
| id | UNIMOD:876 | name | QEQTGG | def | "SUMOylation by SUMO-1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=876] | synonym | "GlnGluGlnThrGlyGly" [] | xref | record_id "876" | xref | delta_mono_mass "600.250354" | xref | delta_avge_mass "600.5789" | xref | delta_composition "H(36) C(23) N(8) O(11)" | xref | username_of_poster "oosula" | xref | group_of_poster "" | xref | date_time_posted "2008-09-09 17:02:45" | xref | date_time_modified "2011-11-25 13:05:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest." | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:877] === UNIMOD:877 QQQTGG |
null .Term [UNIMOD:877] [cols="2*"] |
| id | UNIMOD:877 | name | QQQTGG | def | "SUMOylation by SUMO-2/3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=877] | synonym | "GlnGlnGlnThrGlyGly" [] | xref | record_id "877" | xref | delta_mono_mass "599.266339" | xref | delta_avge_mass "599.5942" | xref | delta_composition "H(37) C(23) N(9) O(10)" | xref | username_of_poster "oosula" | xref | group_of_poster "" | xref | date_time_posted "2008-09-09 17:09:04" | xref | date_time_modified "2008-09-19 19:06:46" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:878] === UNIMOD:878 Bodipy |
null .Term [UNIMOD:878] [cols="2*"] |
| id | UNIMOD:878 | name | Bodipy | def | "Bodipy modifications onto cysteine." [URL:http\://probes.invitrogen.com/handbook/sections/0104.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=878] | synonym | "Which one?" [] | xref | record_id "878" | xref | delta_mono_mass "414.167478" | xref | delta_avge_mass "414.2135" | xref | delta_composition "H(21) B C(20) N(4) O(3) F(2)" | xref | username_of_poster "anikolakakis" | xref | group_of_poster "" | xref | date_time_posted "2008-09-10 20:24:53" | xref | date_time_modified "2008-09-12 18:30:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:884] === UNIMOD:884 Biotin:Thermo-21325 |
null .Term [UNIMOD:884] [cols="2*"] |
| id | UNIMOD:884 | name | Biotin:Thermo-21325 | def | "Was ChromoBiotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=44B1F9DF-B306-4278-B292-6CDB5B3B9D53, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=884] | synonym | "EZ-Link NHS-Chromogenic Biotin" [] | xref | record_id "884" | xref | delta_mono_mass "695.310118" | xref | delta_avge_mass "695.8288" | xref | delta_composition "H(45) C(34) N(7) O(7) S" | xref | username_of_poster "chens002" | xref | group_of_poster "" | xref | date_time_posted "2008-10-20 13:26:20" | xref | date_time_modified "2010-12-03 16:04:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:885] === UNIMOD:885 Label:13C(1)2H(3)+Oxidation |
null .Term [UNIMOD:885] [cols="2*"] |
| id | UNIMOD:885 | name | Label:13C(1)2H(3)+Oxidation | def | "Oxidised methionine 13C(1)2H(3) SILAC label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=885] | xref | record_id "885" | xref | delta_mono_mass "20.0171" | xref | delta_avge_mass "20.0105" | xref | delta_composition "H(-3) 2H(3) C(-1) 13C O" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2008-10-24 09:47:20" | xref | date_time_modified "2009-09-25 13:15:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:886] === UNIMOD:886 HydroxymethylOP |
null .Term [UNIMOD:886] [cols="2*"] |
| id | UNIMOD:886 | name | HydroxymethylOP | def | "2-ammonio-6-[4-(hydroxymethyl)-3-oxidopyridinium-1-yl]- hexanoate." [PMID:12595094, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=886] | xref | record_id "886" | xref | delta_mono_mass "108.021129" | xref | delta_avge_mass "108.0948" | xref | delta_composition "H(4) C(6) O(2)" | xref | username_of_poster "AndrewW" | xref | group_of_poster "" | xref | date_time_posted "2008-11-03 14:35:36" | xref | date_time_modified "2008-11-09 17:49:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "Advanced Glycation Endproduct" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:887] === UNIMOD:887 MDCC |
null .Term [UNIMOD:887] [cols="2*"] |
| id | UNIMOD:887 | name | MDCC | def | "Covalent linkage of maleimidyl coumarin probe (Molecular Probes D-10253)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=887] | comment | MDCC is used extensively as a fluorescent probe to report changes in protein conformation. | synonym | "CAS 156571-46-9 7-diethylamino-3-((((2-maleimidyl)ethyl)amino)carbonyl)coumarin" [] | xref | record_id "887" | xref | delta_mono_mass "383.148121" | xref | delta_avge_mass "383.3978" | xref | delta_composition "H(21) C(20) N(3) O(5)" | xref | username_of_poster "shartson" | xref | group_of_poster "" | xref | date_time_posted "2008-12-03 16:20:46" | xref | date_time_modified "2008-12-05 09:32:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "Due to the mechanism of maleimidyl modification of Cys, the molecular weight of MDCC equals the mass shift created upon crossllinking (no chemical leaving group). During MS/MS, MDCC can reasonably be predicted to fragment readily and at various positions." | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:888] === UNIMOD:888 mTRAQ |
null .Term [UNIMOD:888] [cols="2*"] |
| id | UNIMOD:888 | name | mTRAQ | def | "MTRAQ light." [URL:http\://www3.appliedbiosystems.com/cms/groups/psm_support/documents/generaldocuments/cms_054141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=888] | synonym | "Applied Biosystems mTRAQ™ reagent" [] | xref | record_id "888" | xref | delta_mono_mass "140.094963" | xref | delta_avge_mass "140.183" | xref | delta_composition "H(12) C(7) N(2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2008-12-04 13:50:02" | xref | date_time_modified "2011-11-25 10:30:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "0" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Very low abundance" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_5_misc_notes "Very low abundance" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | xref | spec_6_misc_notes "Very low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:889] === UNIMOD:889 mTRAQ:13C(3)15N(1) |
null .Term [UNIMOD:889] [cols="2*"] |
| id | UNIMOD:889 | name | mTRAQ:13C(3)15N(1) | def | "MTRAQ medium." [URL:http\://www3.appliedbiosystems.com/cms/groups/psm_support/documents/generaldocuments/cms_054141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=889] | synonym | "mTRAQ medium is identical to iTRAQ4plex 117 Applied Biosystems mTRAQ™ reagent" [] | xref | record_id "889" | xref | delta_mono_mass "144.102063" | xref | delta_avge_mass "144.1544" | xref | delta_composition "H(12) C(4) 13C(3) N 15N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2008-12-05 09:26:02" | xref | date_time_modified "2011-11-25 10:34:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "0" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Very low abundance" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_5_misc_notes "Very low abundance" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | xref | spec_6_misc_notes "Very low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:890] === UNIMOD:890 DyLight-maleimide |
null .Term [UNIMOD:890] [cols="2*"] |
| id | UNIMOD:890 | name | DyLight-maleimide | def | "Thiol-reactive dye for fluorescence labelling of proteins." [URL:http\://www.piercenet.com/files/1964as4.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=890] | xref | record_id "890" | xref | delta_mono_mass "940.1999" | xref | delta_avge_mass "941.0762" | xref | delta_composition "H(48) C(39) N(4) O(15) S(4)" | xref | username_of_poster "anikolakakis" | xref | group_of_poster "" | xref | date_time_posted "2008-12-05 15:23:15" | xref | date_time_modified "2008-12-15 12:17:39" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:891] === UNIMOD:891 Methyl-PEO12-Maleimide |
null .Term [UNIMOD:891] [cols="2*"] |
| id | UNIMOD:891 | name | Methyl-PEO12-Maleimide | def | "Methyl-PEO12-Maleimide." [URL:http\://www.piercenet.com/files/1768dh5.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=891] | xref | record_id "891" | xref | delta_mono_mass "710.383719" | xref | delta_avge_mass "710.8073" | xref | delta_composition "H(58) C(32) N(2) O(15)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2008-12-09 11:02:18" | xref | date_time_modified "2008-12-15 12:15:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:893] === UNIMOD:893 CarbamidomethylDTT |
null .Term [UNIMOD:893] [cols="2*"] |
| id | UNIMOD:893 | name | CarbamidomethylDTT | def | "Carbamidomethylated DTT modification of cysteine." [PMID:18653769, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=893] | xref | record_id "893" | xref | delta_mono_mass "209.018035" | xref | delta_avge_mass "209.2864" | xref | delta_composition "H(11) C(6) N O(3) S(2)" | xref | username_of_poster "chalkley" | xref | group_of_poster "" | xref | date_time_posted "2009-01-09 01:39:37" | xref | date_time_modified "2017-06-15 14:11:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:894] === UNIMOD:894 CarboxymethylDTT |
null .Term [UNIMOD:894] [cols="2*"] |
| id | UNIMOD:894 | name | CarboxymethylDTT | def | "Carboxymethylated DTT modification of cysteine." [PMID:18653769, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=894] | xref | record_id "894" | xref | delta_mono_mass "210.00205" | xref | delta_avge_mass "210.2712" | xref | delta_composition "H(10) C(6) O(4) S(2)" | xref | username_of_poster "chalkley" | xref | group_of_poster "" | xref | date_time_posted "2009-01-09 01:43:09" | xref | date_time_modified "2009-01-10 19:03:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:895] === UNIMOD:895 Biotin-PEG-PRA |
null .Term [UNIMOD:895] [cols="2*"] |
| id | UNIMOD:895 | name | Biotin-PEG-PRA | def | "Biotin polyethyleneoxide (n=3) alkyne." [URL:http\://etd.caltech.edu/etd/available/etd-09132005-120123/unrestricted/Chapter2.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=895] | comment | Methionine (C5H11NO2S) is substituted in cell culture by Azidohomoalanine (C4H8N4O2). The azido group reacts with an alkyne group attached to a linker (PEO) with a biotin group at the end (C27H45N5O7S). As a result the side chain of Met (C3H7S) is substitued by C29H49N8O7S. | xref | record_id "895" | xref | delta_mono_mass "578.317646" | xref | delta_avge_mass "578.6611" | xref | delta_composition "H(42) C(26) N(8) O(7)" | xref | username_of_poster "Larsenmarsen" | xref | group_of_poster "" | xref | date_time_posted "2009-01-19 10:54:58" | xref | date_time_modified "2009-02-06 16:50:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:896] === UNIMOD:896 Met→Aha |
null .Term [UNIMOD:896] [cols="2*"] |
| id | UNIMOD:896 | name | Met→Aha | def | "Methionine replacement by azido homoalanine." [PMID:16281315, PMID:11752401, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=896] | xref | record_id "896" | xref | delta_mono_mass "-4.986324" | xref | delta_avge_mass "-5.0794" | xref | delta_composition "H(-3) C(-1) N(3) S(-1)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2009-01-30 14:52:20" | xref | date_time_modified "2009-02-06 16:38:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Non-standard residue" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:897] === UNIMOD:897 Label:15N(4) |
null .Term [UNIMOD:897] [cols="2*"] |
| id | UNIMOD:897 | name | Label:15N(4) | def | "SILAC 15N(4)." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=897] | synonym | "Metabolic labeling with ammonium sulfate (15N)" [] | xref | record_id "897" | xref | delta_mono_mass "3.98814" | xref | delta_avge_mass "3.9736" | xref | delta_composition "N(-4) 15N(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2009-02-06 15:29:55" | xref | date_time_modified "2011-11-21 14:26:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:898] === UNIMOD:898 pyrophospho |
null .Term [UNIMOD:898] [cols="2*"] |
| id | UNIMOD:898 | name | pyrophospho | def | "Pyrophosphorylation of Ser/Thr." [PMID:17873058, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=898] | xref | record_id "898" | xref | delta_mono_mass "159.932662" | xref | delta_avge_mass "159.9598" | xref | delta_composition "H(2) O(6) P(2)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2009-02-23 20:54:00" | xref | date_time_modified "2009-11-11 09:39:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_neutral_loss_177_mono_mass "176.935402" | xref | spec_1_neutral_loss_177_avge_mass "176.9671" | xref | spec_1_neutral_loss_177_flag "false" | xref | spec_1_neutral_loss_177_composition "H(3) O(7) P(2)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_2_neutral_loss_177_mono_mass "176.935402" | xref | spec_2_neutral_loss_177_avge_mass "176.9671" | xref | spec_2_neutral_loss_177_flag "false" | xref | spec_2_neutral_loss_177_composition "H(3) O(7) P(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:899] === UNIMOD:899 Met→Hpg |
null .Term [UNIMOD:899] [cols="2*"] |
| id | UNIMOD:899 | name | Met→Hpg | def | "Methionine replacement by homopropargylglycine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=899] | xref | record_id "899" | xref | delta_mono_mass "-21.987721" | xref | delta_avge_mass "-22.0702" | xref | delta_composition "H(-2) C S(-1)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2009-02-24 17:11:44" | xref | date_time_modified "2009-03-13 16:00:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Non-standard residue" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:901] === UNIMOD:901 4AcAllylGal |
null .Term [UNIMOD:901] [cols="2*"] |
| id | UNIMOD:901 | name | 4AcAllylGal | def | "2,3,4,6-tetra-O-Acetyl-1-allyl-alpha-D-galactopyranoside modification of cysteine." [PMID:18275052, PMID:19798718, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=901] | xref | record_id "901" | xref | delta_mono_mass "372.142033" | xref | delta_avge_mass "372.3671" | xref | delta_composition "H(24) C(17) O(9)" | xref | username_of_poster "paolo.nanni" | xref | group_of_poster "" | xref | date_time_posted "2009-03-06 16:08:43" | xref | date_time_modified "2014-06-23 14:32:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:902] === UNIMOD:902 DimethylArsino |
null .Term [UNIMOD:902] [cols="2*"] |
| id | UNIMOD:902 | name | DimethylArsino | def | "Reaction with dimethylarsinous (AsIII) acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=902] | comment | Protein from animals exposed to organoarsenicals. | xref | record_id "902" | xref | delta_mono_mass "103.960719" | xref | delta_avge_mass "103.9827" | xref | delta_composition "H(5) C(2) As" | xref | username_of_poster "dashford" | xref | group_of_poster "" | xref | date_time_posted "2009-03-09 17:03:27" | xref | date_time_modified "2009-03-13 15:59:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:903] === UNIMOD:903 Lys→CamCys |
null .Term [UNIMOD:903] [cols="2*"] |
| id | UNIMOD:903 | name | Lys→CamCys | def | "Lys→Cys substitution and carbamidomethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=903] | comment | For Brad Strader. | xref | record_id "903" | xref | delta_mono_mass "31.935685" | xref | delta_avge_mass "32.0219" | xref | delta_composition "H(-4) C(-1) O S" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2009-04-17 14:47:30" | xref | date_time_modified "2009-05-01 16:47:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Pre-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:904] === UNIMOD:904 Phe→CamCys |
null .Term [UNIMOD:904] [cols="2*"] |
| id | UNIMOD:904 | name | Phe→CamCys | def | "Phe→Cys substitution and carbamidomethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=904] | comment | For Brad Strader. | xref | record_id "904" | xref | delta_mono_mass "12.962234" | xref | delta_avge_mass "13.0204" | xref | delta_composition "H(-1) C(-4) N O S" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2009-04-17 14:49:02" | xref | date_time_modified "2009-07-13 18:16:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Pre-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:905] === UNIMOD:905 Leu→MetOx |
null .Term [UNIMOD:905] [cols="2*"] |
| id | UNIMOD:905 | name | Leu→MetOx | def | "Leu→Met substitution and sulfoxidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=905] | comment | For Brad Strader. | xref | record_id "905" | xref | delta_mono_mass "33.951335" | xref | delta_avge_mass "34.0378" | xref | delta_composition "H(-2) C(-1) O S" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2009-04-17 14:50:35" | xref | date_time_modified "2009-05-01 16:47:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Pre-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:906] === UNIMOD:906 Lys→MetOx |
null .Term [UNIMOD:906] [cols="2*"] |
| id | UNIMOD:906 | name | Lys→MetOx | def | "Lys→Met substitution and sulfoxidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=906] | comment | For Brad Strader. | xref | record_id "906" | xref | delta_mono_mass "18.940436" | xref | delta_avge_mass "19.0232" | xref | delta_composition "H(-3) C(-1) N(-1) O S" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2009-04-17 14:51:35" | xref | date_time_modified "2009-05-01 16:46:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Pre-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:907] === UNIMOD:907 Galactosyl |
null .Term [UNIMOD:907] [cols="2*"] |
| id | UNIMOD:907 | name | Galactosyl | def | "Gluconoylation." [URL:http\://www.abrf.org/index.cfm/dm.details?DMID=226&AvgMass=all&Margin=0, PMID:743239, PMID:18083862, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=907] | xref | record_id "907" | xref | delta_mono_mass "178.047738" | xref | delta_avge_mass "178.14" | xref | delta_composition "O Hex" | xref | username_of_poster "zientek" | xref | group_of_poster "" | xref | date_time_posted "2009-04-21 18:11:24" | xref | date_time_modified "2015-05-07 11:02:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Other glycosylation" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:908] === UNIMOD:908 X321 |
null .Term [UNIMOD:908] [cols="2*"] |
| id | UNIMOD:908 | name | X321 | def | "Monolink of SMCC terminated with 3-(dimethylamino)-1-propylamine." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011295_SMCC_SulfoSMCC_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=908] | xref | record_id "908" | xref | delta_mono_mass "321.205242" | xref | delta_avge_mass "321.4146" | xref | delta_composition "H(27) C(17) N(3) O(3)" | xref | username_of_poster "anikolakakis" | xref | group_of_poster "" | xref | date_time_posted "2009-04-23 19:39:42" | xref | date_time_modified "2017-09-01 14:46:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:910] === UNIMOD:910 Bacillosamine |
null .Term [UNIMOD:910] [cols="2*"] |
| id | UNIMOD:910 | name | Bacillosamine | def | "2,4-diacetamido-2,4,6-trideoxyglucopyranose." [PMID:12186869, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=910] | synonym | "Asn-linked glycan from Gram-negative Bacterium DATDH" [] | xref | record_id "910" | xref | delta_mono_mass "228.111007" | xref | delta_avge_mass "228.245" | xref | delta_composition "H(6) C(4) N(2) dHex" | xref | username_of_poster "rlmoritz" | xref | group_of_poster "" | xref | date_time_posted "2009-06-23 18:27:32" | xref | date_time_modified "2017-11-29 14:04:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_229_mono_mass "228.111007" | xref | spec_1_neutral_loss_229_avge_mass "228.245" | xref | spec_1_neutral_loss_229_flag "false" | xref | spec_1_neutral_loss_229_composition "H(6) C(4) N(2) dHex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:911] === UNIMOD:911 MTSL |
null .Term [UNIMOD:911] [cols="2*"] |
| id | UNIMOD:911 | name | MTSL | def | "Cys modification by (1-oxyl-2,2,5,5-tetramethyl-3-pyrroline-3-methyl)methanesulfonate (MTSL)." [PMID:9335564, PMID:12441112, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=911] | xref | record_id "911" | xref | delta_mono_mass "184.07961" | xref | delta_avge_mass "184.2786" | xref | delta_composition "H(14) C(9) N O S" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2009-06-25 20:19:40" | xref | date_time_modified "2009-06-26 11:13:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:912] === UNIMOD:912 HNE-BAHAH |
null .Term [UNIMOD:912] [cols="2*"] |
| id | UNIMOD:912 | name | HNE-BAHAH | def | "4-hydroxy-2-nonenal and biotinamidohexanoic acid hydrazide, reduced." [PMID:19054759, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=912] | comment | For Bindu Abraham. | xref | record_id "912" | xref | delta_mono_mass "511.319226" | xref | delta_avge_mass "511.7209" | xref | delta_composition "H(45) C(25) N(5) O(4) S" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2009-07-13 18:23:28" | xref | date_time_modified "2009-07-17 17:49:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:914] === UNIMOD:914 Methylmalonylation |
null .Term [UNIMOD:914] [cols="2*"] |
| id | UNIMOD:914 | name | Methylmalonylation | def | "Methylmalonylation on Serine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=914] | comment | Structural isomer to succinyl. | xref | record_id "914" | xref | delta_mono_mass "100.016044" | xref | delta_avge_mass "100.0728" | xref | delta_composition "H(4) C(4) O(3)" | xref | username_of_poster "xwei" | xref | group_of_poster "" | xref | date_time_posted "2009-07-15 23:43:13" | xref | date_time_modified "2010-11-24 17:59:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:915] === UNIMOD:915 Ethoxyformyl |
null .Term [UNIMOD:915] [cols="2*"] |
| id | UNIMOD:915 | name | Ethoxyformyl | def | "Ethoxyformylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=915] | xref | record_id "915" | xref | delta_mono_mass "72.021129" | xref | delta_avge_mass "72.0627" | xref | delta_composition "H(4) C(3) O(2)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2009-07-24 17:00:29" | xref | date_time_modified "2015-10-30 14:01:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:923] === UNIMOD:923 Label:13C(4)15N(2)+GG |
null .Term [UNIMOD:923] [cols="2*"] |
| id | UNIMOD:923 | name | Label:13C(4)15N(2)+GG | def | "13C(4) 15N(2) Lysine glygly." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=923] | synonym | "heavy glygly lysine" [] | xref | record_id "923" | xref | delta_mono_mass "120.050417" | xref | delta_avge_mass "120.0601" | xref | delta_composition "H(6) 13C(4) 15N(2) O(2)" | xref | username_of_poster "mpcusack" | xref | group_of_poster "" | xref | date_time_posted "2009-09-16 21:04:07" | xref | date_time_modified "2014-07-09 16:53:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "Used in SILAC PTM (glygly) experiment" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:926] === UNIMOD:926 ethylamino |
null .Term [UNIMOD:926] [cols="2*"] |
| id | UNIMOD:926 | name | ethylamino | def | "Ethyl amino." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=926] | comment | Product of beta elimination of phospho- or glycosylated-Ser with addition of ethylamine. | xref | record_id "926" | xref | delta_mono_mass "27.047285" | xref | delta_avge_mass "27.0684" | xref | delta_composition "H(5) C(2) N O(-1)" | xref | username_of_poster "cbatthya" | xref | group_of_poster "" | xref | date_time_posted "2009-09-17 20:37:18" | xref | date_time_modified "2009-10-02 18:21:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:928] === UNIMOD:928 MercaptoEthanol |
null .Term [UNIMOD:928] [cols="2*"] |
| id | UNIMOD:928 | name | MercaptoEthanol | def | "2-OH-ethyl thio-Ser." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=928] | comment | Product of beta elimination of phospho- or glycosylated-Ser with addition of beta Mercapto Ethanol. | xref | record_id "928" | xref | delta_mono_mass "60.003371" | xref | delta_avge_mass "60.1182" | xref | delta_composition "H(4) C(2) S" | xref | username_of_poster "cbatthya" | xref | group_of_poster "" | xref | date_time_posted "2009-09-17 20:43:13" | xref | date_time_modified "2009-10-02 18:23:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:931] === UNIMOD:931 Ethyl+Deamidated |
null .Term [UNIMOD:931] [cols="2*"] |
| id | UNIMOD:931 | name | Ethyl+Deamidated | def | "Deamidation followed by esterification with ethanol." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=931] | xref | record_id "931" | xref | delta_mono_mass "29.015316" | xref | delta_avge_mass "29.0379" | xref | delta_composition "H(3) C(2) N(-1) O" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2009-09-22 11:05:21" | xref | date_time_modified "2012-08-06 14:58:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Q" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:932] === UNIMOD:932 VFQQQTGG |
null .Term [UNIMOD:932] [cols="2*"] |
| id | UNIMOD:932 | name | VFQQQTGG | def | "SUMOylation by SUMO-2/3 (formic acid cleavage)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=932] | synonym | "ValPheGlnGlnGlnThrGlyGly" [] | xref | record_id "932" | xref | delta_mono_mass "845.403166" | xref | delta_avge_mass "845.8991" | xref | delta_composition "H(55) C(37) N(11) O(12)" | xref | username_of_poster "oosula" | xref | group_of_poster "" | xref | date_time_posted "2009-09-24 16:11:11" | xref | date_time_modified "2010-02-02 18:25:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "This peptide is generated from a formic acid digest" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:933] === UNIMOD:933 VIEVYQEQTGG |
null .Term [UNIMOD:933] [cols="2*"] |
| id | UNIMOD:933 | name | VIEVYQEQTGG | def | "SUMOylation by SUMO-1 (formic acid cleavage)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=933] | synonym | "ValIleGluValTyrGlnGluGlnThrGlyGly" [] | xref | record_id "933" | xref | delta_mono_mass "1203.577168" | xref | delta_avge_mass "1204.2859" | xref | delta_composition "H(81) C(53) N(13) O(19)" | xref | username_of_poster "oosula" | xref | group_of_poster "" | xref | date_time_posted "2009-09-24 16:15:34" | xref | date_time_modified "2009-10-02 18:31:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:934] === UNIMOD:934 AMTzHexNAc2 |
null .Term [UNIMOD:934] [cols="2*"] |
| id | UNIMOD:934 | name | AMTzHexNAc2 | def | "Photocleavable Biotin + GalNAz on O-GlcNAc." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=934] | xref | record_id "934" | xref | delta_mono_mass "502.202341" | xref | delta_avge_mass "502.4757" | xref | delta_composition "H(30) C(19) N(6) O(10)" | xref | username_of_poster "mskim" | xref | group_of_poster "" | xref | date_time_posted "2009-10-08 18:05:00" | xref | date_time_modified "2010-10-03 13:45:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:935] === UNIMOD:935 Atto495Maleimide |
null .Term [UNIMOD:935] [cols="2*"] |
| id | UNIMOD:935 | name | Atto495Maleimide | def | "High molecular absorption maleimide label for proteins." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=935] | xref | record_id "935" | xref | delta_mono_mass "474.250515" | xref | delta_avge_mass "474.5747" | xref | delta_composition "H(32) C(27) N(5) O(3)" | xref | username_of_poster "anikolakakis" | xref | group_of_poster "" | xref | date_time_posted "2009-10-14 18:48:56" | xref | date_time_modified "2009-10-16 14:34:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:936] === UNIMOD:936 Chlorination |
null .Term [UNIMOD:936] [cols="2*"] |
| id | UNIMOD:936 | name | Chlorination | def | "Chlorination of tyrosine residues." [PMID:14660678, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=936] | xref | record_id "936" | xref | delta_mono_mass "33.961028" | xref | delta_avge_mass "34.4451" | xref | delta_composition "H(-1) Cl" | xref | username_of_poster "Bryan" | xref | group_of_poster "" | xref | date_time_posted "2009-10-15 17:07:41" | xref | date_time_modified "2017-11-08 16:03:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "W" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:937] === UNIMOD:937 dichlorination |
null .Term [UNIMOD:937] [cols="2*"] |
| id | UNIMOD:937 | name | dichlorination | def | "Dichlorination." [PMID:11733505, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=937] | xref | record_id "937" | xref | delta_mono_mass "67.922055" | xref | delta_avge_mass "68.8901" | xref | delta_composition "H(-2) Cl(2)" | xref | username_of_poster "Bryan" | xref | group_of_poster "" | xref | date_time_posted "2009-10-15 17:12:42" | xref | date_time_modified "2014-05-19 10:13:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:938] === UNIMOD:938 AROD |
null .Term [UNIMOD:938] [cols="2*"] |
| id | UNIMOD:938 | name | AROD | def | "Cysteine modifier." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=938] | comment | The electrophilic moiety of the chemical forms a direct bond with the thiol bond of the cysteine. As a result, there are no losses of elements and the final adduct has the monoisotopic mass of the chemical at 820.3360 added to a cysteine at SH side chain. | xref | record_id "938" | xref | delta_mono_mass "820.336015" | xref | delta_avge_mass "820.979" | xref | delta_composition "H(52) C(35) N(10) O(9) S(2)" | xref | username_of_poster "hbromage" | xref | group_of_poster "" | xref | date_time_posted "2009-10-15 19:27:20" | xref | date_time_modified "2009-10-16 14:41:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:939] === UNIMOD:939 Cys→methylaminoAla |
null .Term [UNIMOD:939] [cols="2*"] |
| id | UNIMOD:939 | name | Cys→methylaminoAla | def | "Carbamidomethylated Cys that undergoes beta-elimination and Michael addition of methylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=939] | xref | record_id "939" | xref | delta_mono_mass "-2.945522" | xref | delta_avge_mass "-3.0238" | xref | delta_composition "H(3) C N S(-1)" | xref | username_of_poster "cbatthya" | xref | group_of_poster "" | xref | date_time_posted "2009-10-16 13:50:33" | xref | date_time_modified "2009-10-16 14:44:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:940] === UNIMOD:940 Cys→ethylaminoAla |
null .Term [UNIMOD:940] [cols="2*"] |
| id | UNIMOD:940 | name | Cys→ethylaminoAla | def | "Carbamidomethylated Cys that undergoes beta-elimination and Michael addition of ethylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=940] | xref | record_id "940" | xref | delta_mono_mass "11.070128" | xref | delta_avge_mass "11.0028" | xref | delta_composition "H(5) C(2) N S(-1)" | xref | username_of_poster "cbatthya" | xref | group_of_poster "" | xref | date_time_posted "2009-10-16 13:53:46" | xref | date_time_modified "2009-10-16 14:44:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:941] === UNIMOD:941 DNPS |
null .Term [UNIMOD:941] [cols="2*"] |
| id | UNIMOD:941 | name | DNPS | def | "2,4-Dinitrobenzenesulfenyl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=941] | synonym | "Trp modification with 2,4-Dinitrobenzenesulfenyl" [] | xref | record_id "941" | xref | delta_mono_mass "198.981352" | xref | delta_avge_mass "199.164" | xref | delta_composition "H(3) C(6) N(2) O(4) S" | xref | username_of_poster "odra.pinato" | xref | group_of_poster "" | xref | date_time_posted "2009-10-19 13:08:56" | xref | date_time_modified "2009-10-30 18:23:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "Fontana A. Biochemistry. vol 7. 980-986 (1968)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "W" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "derivatization of Trp residues using the 2,4-dinitrophenyl-sulfenyl chloride (DNPS-Cl) reagent, that leads to a Trp derivative with the DNPS label attached at 2-position of the indole nucleus." | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:942] === UNIMOD:942 SulfoGMBS |
null .Term [UNIMOD:942] [cols="2*"] |
| id | UNIMOD:942 | name | SulfoGMBS | def | "High molecular absorption label for proteins." [URL:http\://www.piercenet.com/files/1763dh4.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=942] | xref | record_id "942" | xref | delta_mono_mass "458.162391" | xref | delta_avge_mass "458.5306" | xref | delta_composition "H(26) C(22) N(4) O(5) S" | xref | username_of_poster "anikolakakis" | xref | group_of_poster "" | xref | date_time_posted "2009-10-26 19:28:04" | xref | date_time_modified "2009-11-13 17:02:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:943] === UNIMOD:943 DimethylamineGMBS |
null .Term [UNIMOD:943] [cols="2*"] |
| id | UNIMOD:943 | name | DimethylamineGMBS | def | "Modified GMBS X linker." [URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011551_GMBS_SulfoGMBS_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=943] | xref | record_id "943" | xref | delta_mono_mass "267.158292" | xref | delta_avge_mass "267.3241" | xref | delta_composition "H(21) C(13) N(3) O(3)" | xref | username_of_poster "anikolakakis" | xref | group_of_poster "" | xref | date_time_posted "2009-11-04 20:26:57" | xref | date_time_modified "2017-01-18 11:52:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:944] === UNIMOD:944 Label:15N(2)2H(9) |
null .Term [UNIMOD:944] [cols="2*"] |
| id | UNIMOD:944 | name | Label:15N(2)2H(9) | def | "SILAC label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=944] | synonym | "Label:15N(2)2H(9)" [] | xref | record_id "944" | xref | delta_mono_mass "11.050561" | xref | delta_avge_mass "11.0423" | xref | delta_composition "H(-9) 2H(9) N(-2) 15N(2)" | xref | username_of_poster "mskim" | xref | group_of_poster "" | xref | date_time_posted "2009-11-25 22:32:49" | xref | date_time_modified "2009-12-07 20:03:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:946] === UNIMOD:946 LG-anhydrolactam |
null .Term [UNIMOD:946] [cols="2*"] |
| id | UNIMOD:946 | name | LG-anhydrolactam | def | "Levuglandinyl-lysine anhydrolactam adduct." [PMID:10413514, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=946] | xref | record_id "946" | xref | delta_mono_mass "314.188195" | xref | delta_avge_mass "314.4186" | xref | delta_composition "H(26) C(20) O(3)" | xref | username_of_poster "wridenour" | xref | group_of_poster "" | xref | date_time_posted "2010-01-12 01:08:28" | xref | date_time_modified "2011-06-08 18:01:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:947] === UNIMOD:947 LG-pyrrole |
null .Term [UNIMOD:947] [cols="2*"] |
| id | UNIMOD:947 | name | LG-pyrrole | def | "Levuglandinyl-lysine pyrrole adduct." [PMID:10413514, URL:http\://www.hmdb.ca/metabolites/HMDB0005079, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=947] | xref | record_id "947" | xref | delta_mono_mass "316.203845" | xref | delta_avge_mass "316.4345" | xref | delta_composition "H(28) C(20) O(3)" | xref | username_of_poster "wridenour" | xref | group_of_poster "" | xref | date_time_posted "2010-01-12 01:12:38" | xref | date_time_modified "2020-01-21 14:42:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "C" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | xref | spec_3_misc_notes "15-deoxy-PGJ2 (15d-PGJ2) influences multiple signaling pathways by covalently binding with key signaling molecules" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:948] === UNIMOD:948 LG-anhyropyrrole |
null .Term [UNIMOD:948] [cols="2*"] |
| id | UNIMOD:948 | name | LG-anhyropyrrole | def | "Levuglandinyl-lysine anhyropyrrole adduct." [PMID:10413514, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=948] | xref | record_id "948" | xref | delta_mono_mass "298.19328" | xref | delta_avge_mass "298.4192" | xref | delta_composition "H(26) C(20) O(2)" | xref | username_of_poster "wridenour" | xref | group_of_poster "" | xref | date_time_posted "2010-01-12 01:14:46" | xref | date_time_modified "2011-06-08 17:59:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:949] === UNIMOD:949 3-deoxyglucosone |
null .Term [UNIMOD:949] [cols="2*"] |
| id | UNIMOD:949 | name | 3-deoxyglucosone | def | "Condensation product of 3-deoxyglucosone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=949] | xref | record_id "949" | xref | delta_mono_mass "144.042259" | xref | delta_avge_mass "144.1253" | xref | delta_composition "H(8) C(6) O(4)" | xref | username_of_poster "kimzey" | xref | group_of_poster "" | xref | date_time_posted "2010-01-15 18:19:17" | xref | date_time_modified "2010-01-18 13:20:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:950] === UNIMOD:950 Cation:Li |
null .Term [UNIMOD:950] [cols="2*"] |
| id | UNIMOD:950 | name | Cation:Li | def | "Replacement of proton by lithium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=950] | xref | record_id "950" | xref | delta_mono_mass "6.008178" | xref | delta_avge_mass "5.9331" | xref | delta_composition "H(-1) Li" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2010-01-20 12:17:12" | xref | date_time_modified "2010-01-20 12:17:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:951] === UNIMOD:951 Cation:Ca[II] |
null .Term [UNIMOD:951] [cols="2*"] |
| id | UNIMOD:951 | name | Cation:Ca[II] | def | "Replacement of 2 protons by calcium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=951] | xref | record_id "951" | xref | delta_mono_mass "37.946941" | xref | delta_avge_mass "38.0621" | xref | delta_composition "H(-2) Ca" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2010-01-20 12:20:03" | xref | date_time_modified "2010-01-20 12:36:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:952] === UNIMOD:952 Cation:Fe[II] |
null .Term [UNIMOD:952] [cols="2*"] |
| id | UNIMOD:952 | name | Cation:Fe[II] | def | "Replacement of 2 protons by iron." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=952] | xref | record_id "952" | xref | delta_mono_mass "53.919289" | xref | delta_avge_mass "53.8291" | xref | delta_composition "H(-2) Fe" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2010-01-20 12:21:03" | xref | date_time_modified "2010-01-20 12:21:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:953] === UNIMOD:953 Cation:Ni[II] |
null .Term [UNIMOD:953] [cols="2*"] |
| id | UNIMOD:953 | name | Cation:Ni[II] | def | "Replacement of 2 protons by nickel." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=953] | xref | record_id "953" | xref | delta_mono_mass "55.919696" | xref | delta_avge_mass "56.6775" | xref | delta_composition "H(-2) Ni" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2010-01-20 12:22:52" | xref | date_time_modified "2010-01-20 12:22:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:954] === UNIMOD:954 Cation:Zn[II] |
null .Term [UNIMOD:954] [cols="2*"] |
| id | UNIMOD:954 | name | Cation:Zn[II] | def | "Replacement of 2 protons by zinc." [URL:http\://www.uniprot.org/uniprot/P07509, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=954] | xref | record_id "954" | xref | delta_mono_mass "61.913495" | xref | delta_avge_mass "63.3931" | xref | delta_composition "H(-2) Zn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2010-01-20 12:23:59" | xref | date_time_modified "2015-03-19 09:31:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "H" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:955] === UNIMOD:955 Cation:Ag |
null .Term [UNIMOD:955] [cols="2*"] |
| id | UNIMOD:955 | name | Cation:Ag | def | "Replacement of proton by silver." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=955] | xref | record_id "955" | xref | delta_mono_mass "105.897267" | xref | delta_avge_mass "106.8603" | xref | delta_composition "H(-1) Ag" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2010-01-20 12:30:59" | xref | date_time_modified "2010-01-20 12:30:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:956] === UNIMOD:956 Cation:Mg[II] |
null .Term [UNIMOD:956] [cols="2*"] |
| id | UNIMOD:956 | name | Cation:Mg[II] | def | "Replacement of 2 protons by magnesium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=956] | xref | record_id "956" | xref | delta_mono_mass "21.969392" | xref | delta_avge_mass "22.2891" | xref | delta_composition "H(-2) Mg" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2010-01-20 12:36:18" | xref | date_time_modified "2010-01-20 12:36:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:957] === UNIMOD:957 2-succinyl |
null .Term [UNIMOD:957] [cols="2*"] |
| id | UNIMOD:957 | name | 2-succinyl | def | "S-(2-succinyl) cysteine." [PMID:18448829, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=957] | xref | record_id "957" | xref | delta_mono_mass "116.010959" | xref | delta_avge_mass "116.0722" | xref | delta_composition "H(4) C(4) O(4)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-01-26 09:57:53" | xref | date_time_modified "2010-10-15 15:51:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:958] === UNIMOD:958 Propargylamine |
null .Term [UNIMOD:958] [cols="2*"] |
| id | UNIMOD:958 | name | Propargylamine | def | "Propargylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=958] | xref | record_id "958" | xref | delta_mono_mass "37.031634" | xref | delta_avge_mass "37.0632" | xref | delta_composition "H(3) C(3) N O(-1)" | xref | username_of_poster "ywswansea" | xref | group_of_poster "" | xref | date_time_posted "2010-01-26 14:37:33" | xref | date_time_modified "2010-02-01 09:26:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "E" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:959] === UNIMOD:959 Phosphopropargyl |
null .Term [UNIMOD:959] [cols="2*"] |
| id | UNIMOD:959 | name | Phosphopropargyl | def | "Phospho-propargylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=959] | xref | record_id "959" | xref | delta_mono_mass "116.997965" | xref | delta_avge_mass "117.0431" | xref | delta_composition "H(4) C(3) N O(2) P" | xref | username_of_poster "ywswansea" | xref | group_of_poster "" | xref | date_time_posted "2010-01-26 14:42:08" | xref | date_time_modified "2010-02-01 09:25:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Multiple" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Multiple" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:960] === UNIMOD:960 SUMO2135 |
null .Term [UNIMOD:960] [cols="2*"] |
| id | UNIMOD:960 | name | SUMO2135 | def | "SUMOylation by SUMO-1 after tryptic cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=960] | synonym | "ELGMEEEDVIEVYQEQTGG" [] | xref | record_id "960" | xref | delta_mono_mass "2135.920496" | xref | delta_avge_mass "2137.2343" | xref | delta_composition "H(137) C(90) N(21) O(37) S" | xref | username_of_poster "oosula" | xref | group_of_poster "" | xref | date_time_posted "2010-02-02 18:17:15" | xref | date_time_modified "2010-02-14 11:28:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:961] === UNIMOD:961 SUMO3549 |
null .Term [UNIMOD:961] [cols="2*"] |
| id | UNIMOD:961 | name | SUMO3549 | def | "SUMOylation by SUMO-2/3 after tryptic cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=961] | synonym | "FDGQPINETDTPAQLEMEDEDTIDVFQQQTGG" [] | xref | record_id "961" | xref | delta_mono_mass "3549.536568" | xref | delta_avge_mass "3551.6672" | xref | delta_composition "H(224) C(150) N(38) O(60) S" | xref | username_of_poster "oosula" | xref | group_of_poster "" | xref | date_time_posted "2010-02-02 18:21:23" | xref | date_time_modified "2010-02-14 11:27:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:967] === UNIMOD:967 thioacylPA |
null .Term [UNIMOD:967] [cols="2*"] |
| id | UNIMOD:967 | name | thioacylPA | def | "Membrane protein extraction." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=967] | xref | record_id "967" | xref | delta_mono_mass "159.035399" | xref | delta_avge_mass "159.2062" | xref | delta_composition "H(9) C(6) N O(2) S" | xref | username_of_poster "tmiwamoto" | xref | group_of_poster "" | xref | date_time_posted "2010-02-05 06:00:39" | xref | date_time_modified "2010-04-05 21:31:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:971] === UNIMOD:971 maleimide3 |
null .Term [UNIMOD:971] [cols="2*"] |
| id | UNIMOD:971 | name | maleimide3 | def | "Maleimide-3-saccharide." [PMID:18925771, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=971] | comment | Created for Bindu Abraham 12/22/09. | xref | record_id "971" | xref | delta_mono_mass "969.366232" | xref | delta_avge_mass "969.8975" | xref | delta_composition "H(59) C(37) N(7) O(23)" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2010-02-12 17:23:33" | xref | date_time_modified "2010-04-05 21:30:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:972] === UNIMOD:972 maleimide5 |
null .Term [UNIMOD:972] [cols="2*"] |
| id | UNIMOD:972 | name | maleimide5 | def | "Maleimide-5-saccharide." [PMID:18925771, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=972] | comment | Created for Bindu Abraham 12/22/09. | xref | record_id "972" | xref | delta_mono_mass "1293.471879" | xref | delta_avge_mass "1294.1787" | xref | delta_composition "H(79) C(49) N(7) O(33)" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2010-02-12 17:25:52" | xref | date_time_modified "2010-04-05 21:29:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:973] === UNIMOD:973 Puromycin |
null .Term [UNIMOD:973] [cols="2*"] |
| id | UNIMOD:973 | name | Puromycin | def | "Puromycin." [PMID:10666460, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=973] | comment | Created for Michael (Brad) Strader 2/12/10. | xref | record_id "973" | xref | delta_mono_mass "453.212452" | xref | delta_avge_mass "453.4943" | xref | delta_composition "H(27) C(22) N(7) O(4)" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2010-02-12 20:50:31" | xref | date_time_modified "2010-04-12 15:38:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Co-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:977] === UNIMOD:977 Carbofuran |
null .Term [UNIMOD:977] [cols="2*"] |
| id | UNIMOD:977 | name | Carbofuran | def | "2,3-dihydro-2,2-dimethyl-7-benzofuranol N-methyl carbamate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=977] | xref | record_id "977" | xref | delta_mono_mass "58.029289" | xref | delta_avge_mass "58.0593" | xref | delta_composition "H(4) C(2) N O" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2010-02-24 21:10:32" | xref | date_time_modified "2010-04-05 21:27:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:978] === UNIMOD:978 BITC |
null .Term [UNIMOD:978] [cols="2*"] |
| id | UNIMOD:978 | name | BITC | def | "Benzyl isothiocyanate." [PMID:22835833, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=978] | xref | record_id "978" | xref | delta_mono_mass "149.02992" | xref | delta_avge_mass "149.2129" | xref | delta_composition "H(7) C(8) N S" | xref | username_of_poster "miyoshin" | xref | group_of_poster "" | xref | date_time_posted "2010-03-09 09:42:12" | xref | date_time_modified "2013-04-26 06:26:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:979] === UNIMOD:979 PEITC |
null .Term [UNIMOD:979] [cols="2*"] |
| id | UNIMOD:979 | name | PEITC | def | "Phenethyl isothiocyanate." [PMID:22835833, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=979] | xref | record_id "979" | xref | delta_mono_mass "163.04557" | xref | delta_avge_mass "163.2395" | xref | delta_composition "H(9) C(9) N S" | xref | username_of_poster "miyoshin" | xref | group_of_poster "" | xref | date_time_posted "2010-03-09 10:06:18" | xref | date_time_modified "2013-04-26 06:27:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:981] === UNIMOD:981 glucosone |
null .Term [UNIMOD:981] [cols="2*"] |
| id | UNIMOD:981 | name | glucosone | def | "Condensation product of glucosone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=981] | xref | record_id "981" | xref | delta_mono_mass "160.037173" | xref | delta_avge_mass "160.1247" | xref | delta_composition "H(8) C(6) O(5)" | xref | username_of_poster "kimzey" | xref | group_of_poster "" | xref | date_time_posted "2010-03-31 00:28:53" | xref | date_time_modified "2010-04-05 21:25:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:984] === UNIMOD:984 cysTMT |
null .Term [UNIMOD:984] [cols="2*"] |
| id | UNIMOD:984 | name | cysTMT | def | "Native cysteine-reactive Tandem Mass Tag®." [URL:http\://bit.ly/1GBnaC8, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=984] | comment | This modification describes the native cysteine-reactive cysTMT Reagent without isotopic label. Upon CID, this reagent releases a reporter ion of 126.127725 (monoisotopic mass). | synonym | "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] | xref | record_id "984" | xref | delta_mono_mass "299.166748" | xref | delta_avge_mass "299.4322" | xref | delta_composition "H(25) C(14) N(3) O(2) S" | xref | username_of_poster "jorogers6" | xref | group_of_poster "" | xref | date_time_posted "2010-04-22 21:57:44" | xref | date_time_modified "2014-11-08 16:06:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:985] === UNIMOD:985 cysTMT6plex |
null .Term [UNIMOD:985] [cols="2*"] |
| id | UNIMOD:985 | name | cysTMT6plex | def | "Cysteine-reactive Sixplex Tandem Mass Tag®." [URL:http\://bit.ly/1GBnaC8, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=985] | comment | This modification describes the isobaric sixplex cysteine-reactive cysTMT6 Reagents with isotopic labels. Upon CID, these reagents release reporter ions of 126.127725, 127.131079, 128.134433, 129.137787, 130.141141, and 131.138176 (monoisotopic mass). | synonym | "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] | xref | record_id "985" | xref | delta_mono_mass "304.177202" | xref | delta_avge_mass "304.3962" | xref | delta_composition "H(25) C(10) 13C(4) N(2) 15N O(2) S" | xref | username_of_poster "jorogers6" | xref | group_of_poster "" | xref | date_time_posted "2010-04-22 22:05:46" | xref | date_time_modified "2016-09-22 14:38:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:986] === UNIMOD:986 Label:13C(6)+Dimethyl |
null .Term [UNIMOD:986] [cols="2*"] |
| id | UNIMOD:986 | name | Label:13C(6)+Dimethyl | def | "Dimethyl 13C(6) Silac label." [FindMod:DIMETH, URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:http://www.ncbi.nlm.nih.gov/pubmed/14670044?dopt=AbstractPlus, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=986] | xref | record_id "986" | xref | delta_mono_mass "34.051429" | xref | delta_avge_mass "34.0091" | xref | delta_composition "H(4) C(-4) 13C(6)" | xref | username_of_poster "glick2" | xref | group_of_poster "" | xref | date_time_posted "2010-05-09 10:48:19" | xref | date_time_modified "2010-05-14 16:19:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "SILAC+PTM" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:987] === UNIMOD:987 Label:13C(6)15N(2)+Dimethyl |
null .Term [UNIMOD:987] [cols="2*"] |
| id | UNIMOD:987 | name | Label:13C(6)15N(2)+Dimethyl | def | "Dimethyl 13C(6)15N(2) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, FindMod:DIMETH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=987] | xref | record_id "987" | xref | delta_mono_mass "36.045499" | xref | delta_avge_mass "35.9959" | xref | delta_composition "H(4) C(-4) 13C(6) N(-2) 15N(2)" | xref | username_of_poster "glick2" | xref | group_of_poster "" | xref | date_time_posted "2010-05-09 10:57:55" | xref | date_time_modified "2010-05-14 16:20:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_1_misc_notes "SILAC+PTM" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:989] === UNIMOD:989 Ammonium |
null .Term [UNIMOD:989] [cols="2*"] |
| id | UNIMOD:989 | name | Ammonium | def | "Replacement of proton with ammonium ion." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=989] | comment | Sometimes observed after elution of phosphopeptides from TiO2 with ammonium hydroxide. | xref | record_id "989" | xref | delta_mono_mass "17.026549" | xref | delta_avge_mass "17.0305" | xref | delta_composition "H(3) N" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-05-18 10:32:03" | xref | date_time_modified "2010-06-04 15:08:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:991] === UNIMOD:991 ISD_z+2_ion |
null .Term [UNIMOD:991] [cols="2*"] |
| id | UNIMOD:991 | name | ISD_z+2_ion | def | "ISD (z+2)-series." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=991] | xref | record_id "991" | xref | delta_mono_mass "-15.010899" | xref | delta_avge_mass "-15.0146" | xref | delta_composition "H(-1) N(-1)" | xref | username_of_poster "suckau" | xref | group_of_poster "" | xref | date_time_posted "2010-06-08 09:42:52" | xref | date_time_modified "2010-06-28 10:47:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Artefact" | xref | spec_1_misc_notes "this is a "virtual modification", as it only accounts for the structure of the MS/MS fragment as it occurs in Top-Down MS/MS analyses. This must be accounted for in MS³-analysis of z+2 ions" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:993] === UNIMOD:993 Biotin:Sigma-B1267 |
null .Term [UNIMOD:993] [cols="2*"] |
| id | UNIMOD:993 | name | Biotin:Sigma-B1267 | def | "Was Biotin-maleimide." [PMID:15449375, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=993] | synonym | "maleimide biotinylated" [] | xref | record_id "993" | xref | delta_mono_mass "449.17329" | xref | delta_avge_mass "449.5239" | xref | delta_composition "H(27) C(20) N(5) O(5) S" | xref | username_of_poster "mpcusack" | xref | group_of_poster "" | xref | date_time_posted "2010-06-10 07:50:00" | xref | date_time_modified "2010-12-03 16:02:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:994] === UNIMOD:994 Label:15N(1) |
null .Term [UNIMOD:994] [cols="2*"] |
| id | UNIMOD:994 | name | Label:15N(1) | def | "15N(1)." [PMID:19664813, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=994] | synonym | "Metabolic labeling with ammonium sulfate (15N)" [] | xref | record_id "994" | xref | delta_mono_mass "0.997035" | xref | delta_avge_mass "0.9934" | xref | delta_composition "N(-1) 15N" | xref | username_of_poster "ppicotti" | xref | group_of_poster "" | xref | date_time_posted "2010-06-22 14:52:08" | xref | date_time_modified "2011-11-21 14:26:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Y" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "G" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "A" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "P" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "V" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Isotopic label" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "T" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Isotopic label" | xref | spec_9_group "9" | xref | spec_9_hidden "1" | xref | spec_9_site "C" | xref | spec_9_position "Anywhere" | xref | spec_9_classification "Isotopic label" | xref | spec_10_group "10" | xref | spec_10_hidden "1" | xref | spec_10_site "I" | xref | spec_10_position "Anywhere" | xref | spec_10_classification "Isotopic label" | xref | spec_11_group "11" | xref | spec_11_hidden "1" | xref | spec_11_site "L" | xref | spec_11_position "Anywhere" | xref | spec_11_classification "Isotopic label" | xref | spec_12_group "12" | xref | spec_12_hidden "1" | xref | spec_12_site "D" | xref | spec_12_position "Anywhere" | xref | spec_12_classification "Isotopic label" | xref | spec_13_group "13" | xref | spec_13_hidden "1" | xref | spec_13_site "E" | xref | spec_13_position "Anywhere" | xref | spec_13_classification "Isotopic label" | xref | spec_14_group "14" | xref | spec_14_hidden "1" | xref | spec_14_site "M" | xref | spec_14_position "Anywhere" | xref | spec_14_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:995] === UNIMOD:995 Label:15N(2) |
null .Term [UNIMOD:995] [cols="2*"] |
| id | UNIMOD:995 | name | Label:15N(2) | def | "15N(2)." [PMID:19664813, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=995] | synonym | "Metabolic labeling with ammonium sulfate (15N)" [] | xref | record_id "995" | xref | delta_mono_mass "1.99407" | xref | delta_avge_mass "1.9868" | xref | delta_composition "N(-2) 15N(2)" | xref | username_of_poster "ppicotti" | xref | group_of_poster "" | xref | date_time_posted "2010-06-22 15:29:02" | xref | date_time_modified "2011-11-21 14:26:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Q" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "W" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:996] === UNIMOD:996 Label:15N(3) |
null .Term [UNIMOD:996] [cols="2*"] |
| id | UNIMOD:996 | name | Label:15N(3) | def | "15N(3)." [PMID:19664813, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=996] | synonym | "Metabolic labeling with ammonium sulfate (15N)" [] | xref | record_id "996" | xref | delta_mono_mass "2.991105" | xref | delta_avge_mass "2.9802" | xref | delta_composition "N(-3) 15N(3)" | xref | username_of_poster "ppicotti" | xref | group_of_poster "" | xref | date_time_posted "2010-06-22 15:30:28" | xref | date_time_modified "2011-11-21 14:26:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:997] === UNIMOD:997 sulfo+amino |
null .Term [UNIMOD:997] [cols="2*"] |
| id | UNIMOD:997 | name | sulfo+amino | def | "Aminotyrosine with sulfation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=997] | synonym | "amino_sulfate" [] | xref | record_id "997" | xref | delta_mono_mass "94.967714" | xref | delta_avge_mass "95.0778" | xref | delta_composition "H N O(3) S" | xref | username_of_poster "huidouzi" | xref | group_of_poster "" | xref | date_time_posted "2010-06-23 18:50:14" | xref | date_time_modified "2010-06-28 10:29:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1000] === UNIMOD:1000 AHA-Alkyne |
null .Term [UNIMOD:1000] [cols="2*"] |
| id | UNIMOD:1000 | name | AHA-Alkyne | def | "Azidohomoalanine (AHA) bound to propargylglycine-NH2 (alkyne)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1000] | comment | Methionine (C5H11NO2S) is substituted in culture with azidohomoalanine (AHA - C4H8N4O2). The azide group reacts with the alkyne group propargylglycine-NH2. As a result the side chain of methionine (C3H7S) is substituted by C7H12N5O. | xref | record_id "1000" | xref | delta_mono_mass "107.077339" | xref | delta_avge_mass "107.0504" | xref | delta_composition "H(5) C(4) N(5) O S(-1)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-09-28 09:28:15" | xref | date_time_modified "2010-10-03 13:44:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1001] === UNIMOD:1001 AHA-Alkyne-KDDDD |
null .Term [UNIMOD:1001] [cols="2*"] |
| id | UNIMOD:1001 | name | AHA-Alkyne-KDDDD | def | "Azidohomoalanine (AHA) bound to DDDDK-propargylglycine-NH2 (alkyne)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1001] | comment | Methionine (C5H11NO2S) is substituted in culture with azidohomoalanine (AHA - C4H8N4O2). The azide group reacts with the alkyne group DDDDK-propargylglycine-NH2. As a result the side chain of methionine (C3H7S) is substituted by C29H44N11O14. | xref | record_id "1001" | xref | delta_mono_mass "695.280074" | xref | delta_avge_mass "695.5723" | xref | delta_composition "H(37) C(26) N(11) O(14) S(-1)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-09-28 09:35:48" | xref | date_time_modified "2010-10-03 13:44:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1002] === UNIMOD:1002 EGCG1 |
null .Term [UNIMOD:1002] [cols="2*"] |
| id | UNIMOD:1002 | name | EGCG1 | def | "(-)-epigallocatechin-3-gallate." [PMID:18771724, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1002] | comment | Created for Bindu Abraham 2010-10-05. | xref | record_id "1002" | xref | delta_mono_mass "456.069261" | xref | delta_avge_mass "456.3558" | xref | delta_composition "H(16) C(22) O(11)" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2010-10-05 20:46:40" | xref | date_time_modified "2010-12-23 15:47:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1003] === UNIMOD:1003 EGCG2 |
null .Term [UNIMOD:1003] [cols="2*"] |
| id | UNIMOD:1003 | name | EGCG2 | def | "(-)-dehydroepigallocatechin." [PMID:18771724, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1003] | comment | Created for Bindu Abraham 2010-10-05. | xref | record_id "1003" | xref | delta_mono_mass "287.055563" | xref | delta_avge_mass "287.2442" | xref | delta_composition "H(11) C(15) O(6)" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2010-10-05 20:48:38" | xref | date_time_modified "2010-12-23 15:47:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1004] === UNIMOD:1004 Label:13C(6)15N(4)+Methyl |
null .Term [UNIMOD:1004] [cols="2*"] |
| id | UNIMOD:1004 | name | Label:13C(6)15N(4)+Methyl | def | "Monomethylated Arg13C(6) 15N(4)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1004] | xref | record_id "1004" | xref | delta_mono_mass "24.023919" | xref | delta_avge_mass "23.9561" | xref | delta_composition "H(2) C(-5) 13C(6) N(-4) 15N(4)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-10-27 10:36:31" | xref | date_time_modified "2010-11-05 16:47:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1005] === UNIMOD:1005 Label:13C(6)15N(4)+Dimethyl |
null .Term [UNIMOD:1005] [cols="2*"] |
| id | UNIMOD:1005 | name | Label:13C(6)15N(4)+Dimethyl | def | "Dimethylated Arg13C(6) 15N(4)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1005] | xref | record_id "1005" | xref | delta_mono_mass "38.039569" | xref | delta_avge_mass "37.9827" | xref | delta_composition "H(4) C(-4) 13C(6) N(-4) 15N(4)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-10-27 10:52:10" | xref | date_time_modified "2010-11-05 16:49:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1006] === UNIMOD:1006 Label:13C(6)15N(4)+Methyl:2H(3)13C(1) |
null .Term [UNIMOD:1006] [cols="2*"] |
| id | UNIMOD:1006 | name | Label:13C(6)15N(4)+Methyl:2H(3)13C(1) | def | "2H(3) 13C(1) monomethylated Arg13C(6) 15N(4)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1006] | xref | record_id "1006" | xref | delta_mono_mass "28.046104" | xref | delta_avge_mass "27.9673" | xref | delta_composition "H(-1) 2H(3) C(-6) 13C(7) N(-4) 15N(4)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-10-27 10:59:21" | xref | date_time_modified "2010-11-05 16:53:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1007] === UNIMOD:1007 Label:13C(6)15N(4)+Dimethyl:2H(6)13C(2) |
null .Term [UNIMOD:1007] [cols="2*"] |
| id | UNIMOD:1007 | name | Label:13C(6)15N(4)+Dimethyl:2H(6)13C(2) | def | "2H(6) 13C(2) Dimethylated Arg13C(6) 15N(4)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1007] | xref | record_id "1007" | xref | delta_mono_mass "46.083939" | xref | delta_avge_mass "46.005" | xref | delta_composition "H(-2) 2H(6) C(-6) 13C(8) N(-4) 15N(4)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-10-27 11:07:29" | xref | date_time_modified "2010-11-05 16:54:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1008] === UNIMOD:1008 Cys→CamSec |
null .Term [UNIMOD:1008] [cols="2*"] |
| id | UNIMOD:1008 | name | Cys→CamSec | def | "Sec Iodoacetamide derivative." [PMID:18283440, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1008] | synonym | "Carboxyamidomethylation of selenocysteine" [] | xref | record_id "1008" | xref | delta_mono_mass "104.965913" | xref | delta_avge_mass "103.9463" | xref | delta_composition "H(3) C(2) N O S(-1) Se" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-11-04 12:00:12" | xref | date_time_modified "2016-02-01 14:19:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Non-standard residue" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1009] === UNIMOD:1009 Thiazolidine |
null .Term [UNIMOD:1009] [cols="2*"] |
| id | UNIMOD:1009 | name | Thiazolidine | def | "Formaldehyde adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1009] | synonym | "thiazolidine-2-carboxylic acid" [] | xref | record_id "1009" | xref | delta_mono_mass "12" | xref | delta_avge_mass "12.0107" | xref | delta_composition "C" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2010-11-04 12:29:10" | xref | date_time_modified "2017-03-30 16:37:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "R" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "H" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "W" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Chemical derivative" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "F" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1010] === UNIMOD:1010 DEDGFLYMVYASQETFG |
null .Term [UNIMOD:1010] [cols="2*"] |
| id | UNIMOD:1010 | name | DEDGFLYMVYASQETFG | def | "Addition of DEDGFLYMVYASQETFG." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1010] | xref | record_id "1010" | xref | delta_mono_mass "1970.824411" | xref | delta_avge_mass "1972.088" | xref | delta_composition "H(122) C(89) N(18) O(31) S" | xref | username_of_poster "hbromage" | xref | group_of_poster "" | xref | date_time_posted "2010-11-04 17:27:46" | xref | date_time_modified "2010-11-24 18:00:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_neutral_loss_19_mono_mass "18.010565" | xref | spec_1_neutral_loss_19_avge_mass "18.0153" | xref | spec_1_neutral_loss_19_flag "false" | xref | spec_1_neutral_loss_19_composition "Water" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1012] === UNIMOD:1012 Biotin:Invitrogen-M1602 |
null .Term [UNIMOD:1012] [cols="2*"] |
| id | UNIMOD:1012 | name | Biotin:Invitrogen-M1602 | def | "Nalpha-(3-maleimidylpropionyl)biocytin." [URL:http\://products.invitrogen.com/ivgn/product/M1602?ICID=search-m1602, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1012] | synonym | "Reference M1602 Invitrogen" [] | xref | record_id "1012" | xref | delta_mono_mass "523.210069" | xref | delta_avge_mass "523.6024" | xref | delta_composition "H(33) C(23) N(5) O(7) S" | xref | username_of_poster "camoin" | xref | group_of_poster "" | xref | date_time_posted "2010-11-16 10:11:53" | xref | date_time_modified "2010-12-03 15:58:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1014] === UNIMOD:1014 glycidamide |
null .Term [UNIMOD:1014] [cols="2*"] |
| id | UNIMOD:1014 | name | glycidamide | def | "Glycidamide adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1014] | xref | record_id "1014" | xref | delta_mono_mass "87.032028" | xref | delta_avge_mass "87.0773" | xref | delta_composition "H(5) C(3) N O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2010-12-21 17:00:41" | xref | date_time_modified "2010-12-21 17:00:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1015] === UNIMOD:1015 Ahx2+Hsl |
null .Term [UNIMOD:1015] [cols="2*"] |
| id | UNIMOD:1015 | name | Ahx2+Hsl | def | "C-terminal homoserine lactone and two aminohexanoic acids." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1015] | xref | record_id "1015" | xref | delta_mono_mass "309.205242" | xref | delta_avge_mass "309.4039" | xref | delta_composition "H(27) C(16) N(3) O(3)" | xref | username_of_poster "kpkent" | xref | group_of_poster "" | xref | date_time_posted "2010-12-22 10:13:01" | xref | date_time_modified "2011-01-07 17:06:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Non-standard residue" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1017] === UNIMOD:1017 DMPO |
null .Term [UNIMOD:1017] [cols="2*"] |
| id | UNIMOD:1017 | name | DMPO | def | "DMPO spin-trap nitrone adduct." [PMID:18160050, PMID:17637042, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1017] | comment | Created for Bindu Abraham 2011-01-25. | xref | record_id "1017" | xref | delta_mono_mass "111.068414" | xref | delta_avge_mass "111.1418" | xref | delta_composition "H(9) C(6) N O" | xref | username_of_poster "hooverdm" | xref | group_of_poster "" | xref | date_time_posted "2011-01-25 18:30:32" | xref | date_time_modified "2011-02-28 17:17:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1018] === UNIMOD:1018 ICDID |
null .Term [UNIMOD:1018] [cols="2*"] |
| id | UNIMOD:1018 | name | ICDID | def | "Isotope-Coded Dimedone light form." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1018] | xref | record_id "1018" | xref | delta_mono_mass "138.06808" | xref | delta_avge_mass "138.1638" | xref | delta_composition "H(10) C(8) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-02-02 17:23:34" | xref | date_time_modified "2011-02-02 17:23:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1019] === UNIMOD:1019 ICDID:2H(6) |
null .Term [UNIMOD:1019] [cols="2*"] |
| id | UNIMOD:1019 | name | ICDID:2H(6) | def | "Isotope-Coded Dimedone heavy form." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1019] | xref | record_id "1019" | xref | delta_mono_mass "144.10574" | xref | delta_avge_mass "144.2008" | xref | delta_composition "H(4) 2H(6) C(8) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-02-02 17:24:45" | xref | date_time_modified "2011-02-02 17:24:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1020] === UNIMOD:1020 X156 |
null .Term [UNIMOD:1020] [cols="2*"] |
| id | UNIMOD:1020 | name | X156 | def | "Water-quenched monolink of DSS/BS3 crosslinker." [PMID:8326953, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1020] | xref | record_id "1020" | xref | delta_mono_mass "156.078644" | xref | delta_avge_mass "156.1791" | xref | delta_composition "H(12) C(8) O(3)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2011-02-07 14:20:22" | xref | date_time_modified "2017-08-17 15:09:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1021] === UNIMOD:1021 X244 |
null .Term [UNIMOD:1021] [cols="2*"] |
| id | UNIMOD:1021 | name | X244 | def | "Water quenched monolink of EGS cross-linker." [PMID:36892, URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011281_EGS_SulfoEGS_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1021] | synonym | "Ethylene glycolbis(succinimidylsuccinate)" [] | xref | record_id "1021" | xref | delta_mono_mass "244.058303" | xref | delta_avge_mass "244.1981" | xref | delta_composition "H(12) C(10) O(7)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2011-02-07 17:40:36" | xref | date_time_modified "2017-08-17 15:10:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1022] === UNIMOD:1022 X132 |
null .Term [UNIMOD:1022] [cols="2*"] |
| id | UNIMOD:1022 | name | X132 | def | "Water quenched monolink of DST crosslinker." [PMID:212103, URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011282_DST_UG.pdf, PMID:3001048, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1022] | xref | record_id "1022" | xref | delta_mono_mass "132.005873" | xref | delta_avge_mass "132.0716" | xref | delta_composition "H(4) C(4) O(5)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2011-02-07 18:02:58" | xref | date_time_modified "2017-08-18 14:26:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1023] === UNIMOD:1023 X192 |
null .Term [UNIMOD:1023] [cols="2*"] |
| id | UNIMOD:1023 | name | X192 | def | "Water quenched monolink of DSP/DTSSP crosslinker." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011280_DTSSP_DSP_UG.pdf, PMID:1262347, PMID:8457554, PMID:322714, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1023] | synonym | "Also known as DSP" [] | xref | record_id "1023" | xref | delta_mono_mass "191.991486" | xref | delta_avge_mass "192.2559" | xref | delta_composition "H(8) C(6) O(3) S(2)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2011-02-07 18:22:31" | xref | date_time_modified "2017-08-18 14:53:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1024] === UNIMOD:1024 X237 |
null .Term [UNIMOD:1024] [cols="2*"] |
| id | UNIMOD:1024 | name | X237 | def | "Water quenched monolink of SMCC." [PMID:6490581, PMID:1931231, URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011295_SMCC_SulfoSMCC_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1024] | xref | record_id "1024" | xref | delta_mono_mass "237.100108" | xref | delta_avge_mass "237.2518" | xref | delta_composition "H(15) C(12) N O(4)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2011-02-07 19:33:39" | xref | date_time_modified "2017-09-05 15:09:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1027] === UNIMOD:1027 X140 |
null .Term [UNIMOD:1027] [cols="2*"] |
| id | UNIMOD:1027 | name | X140 | def | "Water quenched monolink of DMP crosslinker." [PMID:2144419, PMID:14696200, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1027] | synonym | "Dimethyl pimelimidate dead-end crosslink" [] | xref | record_id "1027" | xref | delta_mono_mass "140.094963" | xref | delta_avge_mass "140.183" | xref | delta_composition "H(12) C(7) N(2) O" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2011-02-25 16:18:13" | xref | date_time_modified "2017-08-18 10:17:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1028] === UNIMOD:1028 X115 |
null .Term [UNIMOD:1028] [cols="2*"] |
| id | UNIMOD:1028 | name | X115 | def | "Cleavage product of EGS protein crosslinks by hydroylamine treatment." [PMID:36892, URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011281_EGS_SulfoEGS_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1028] | synonym | "Ethylene glycolbis(succinimidylsuccinate)" [] | xref | record_id "1028" | xref | delta_mono_mass "115.026943" | xref | delta_avge_mass "115.0874" | xref | delta_composition "H(5) C(4) N O(3)" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2011-02-25 17:16:45" | xref | date_time_modified "2017-08-17 15:10:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1031] === UNIMOD:1031 Biotin:Thermo-88310 |
null .Term [UNIMOD:1031] [cols="2*"] |
| id | UNIMOD:1031 | name | Biotin:Thermo-88310 | def | "Desthiobiotin modification of lysine." [URL:http\://www.lifetechnologies.com/order/catalog/product/88310, URL:http\://www.lifetechnologies.com/order/catalog/product/88314, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1031] | synonym | "desthiobiotin-GTP desthiobiotin-ADP desthiobiotin-ATP" [] | xref | record_id "1031" | xref | delta_mono_mass "196.121178" | xref | delta_avge_mass "196.2462" | xref | delta_composition "H(16) C(10) N(2) O(2)" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2011-03-02 20:33:20" | xref | date_time_modified "2015-04-20 16:11:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1032] === UNIMOD:1032 2-nitrobenzyl |
null .Term [UNIMOD:1032] [cols="2*"] |
| id | UNIMOD:1032 | name | 2-nitrobenzyl | def | "Tyrosine caged with 2-nitrobenzyl (ONB)." [PMID:16548032, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1032] | xref | record_id "1032" | xref | delta_mono_mass "135.032028" | xref | delta_avge_mass "135.1201" | xref | delta_composition "H(5) C(7) N O(2)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-03-14 10:56:33" | xref | date_time_modified "2011-03-18 13:39:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1033] === UNIMOD:1033 Cys→SecNEM |
null .Term [UNIMOD:1033] [cols="2*"] |
| id | UNIMOD:1033 | name | Cys→SecNEM | def | "N-ethylmaleimide on selenocysteines." [URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:18283440, PMID:12777388, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1033] | synonym | "SecNEM" [] | xref | record_id "1033" | xref | delta_mono_mass "172.992127" | xref | delta_avge_mass "172.0203" | xref | delta_composition "H(7) C(6) N O(2) S(-1) Se" | xref | username_of_poster "mpcusack" | xref | group_of_poster "" | xref | date_time_posted "2011-03-31 18:29:45" | xref | date_time_modified "2016-02-01 14:20:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Non-standard residue" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1034] === UNIMOD:1034 Cys→SecNEM:2H(5) |
null .Term [UNIMOD:1034] [cols="2*"] |
| id | UNIMOD:1034 | name | Cys→SecNEM:2H(5) | def | "D5 N-ethylmaleimide on selenocysteines." [PMID:18283440, PMID:12777388, URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1034] | synonym | "SecNEM D5" [] | xref | record_id "1034" | xref | delta_mono_mass "178.023511" | xref | delta_avge_mass "177.0511" | xref | delta_composition "H(2) 2H(5) C(6) N O(2) S(-1) Se" | xref | username_of_poster "mpcusack" | xref | group_of_poster "" | xref | date_time_posted "2011-03-31 18:32:32" | xref | date_time_modified "2016-02-01 14:20:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1035] === UNIMOD:1035 Thiadiazole |
null .Term [UNIMOD:1035] [cols="2*"] |
| id | UNIMOD:1035 | name | Thiadiazole | def | "Thiadiazolydation of Cys." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1035] | xref | record_id "1035" | xref | delta_mono_mass "174.025169" | xref | delta_avge_mass "174.2223" | xref | delta_composition "H(6) C(9) N(2) S" | xref | username_of_poster "cbatthya" | xref | group_of_poster "" | xref | date_time_posted "2011-04-01 16:26:52" | xref | date_time_modified "2011-04-08 16:38:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1036] === UNIMOD:1036 Withaferin |
null .Term [UNIMOD:1036] [cols="2*"] |
| id | UNIMOD:1036 | name | Withaferin | def | "Modification of cystein by withaferin." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/21432907, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1036] | xref | record_id "1036" | xref | delta_mono_mass "470.266839" | xref | delta_avge_mass "470.5977" | xref | delta_composition "H(38) C(28) O(6)" | xref | username_of_poster "ProtUA" | xref | group_of_poster "" | xref | date_time_posted "2011-04-06 12:31:40" | xref | date_time_modified "2011-04-08 16:37:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1037] === UNIMOD:1037 Biotin:Thermo-88317 |
null .Term [UNIMOD:1037] [cols="2*"] |
| id | UNIMOD:1037 | name | Biotin:Thermo-88317 | def | "Desthiobiotin fluorophosphonate." [URL:http\://www.lifetechnologies.com/order/catalog/product/88317, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1037] | comment | Dethiobiotin-FP was designed to label the active site serine of serine hydrolases (e.g. esterases, peptidases, lipases). | synonym | "desthiobiotin-alkyl-FP desthiobiotin-FP" [] | xref | record_id "1037" | xref | delta_mono_mass "443.291294" | xref | delta_avge_mass "443.5603" | xref | delta_composition "H(42) C(22) N(3) O(4) P" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2011-05-06 19:40:48" | xref | date_time_modified "2015-04-20 16:24:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1038] === UNIMOD:1038 TAMRA-FP |
null .Term [UNIMOD:1038] [cols="2*"] |
| id | UNIMOD:1038 | name | TAMRA-FP | def | "TAMRA fluorophosphonate modification of serine." [URL:http\://www.piercenet.com/browse.cfm?fldID=0842EF3A-D867-AEA2-6E77-E84116CAA87C, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1038] | comment | TAMRA-FP was designed to label the active site serine of serine hydrolases (e.g. esterases, peptidases, lipases). | synonym | "ActivX TAMRA-FP Serine Hydrolase Probe TAMRA-alkyl-FP" [] | xref | record_id "1038" | xref | delta_mono_mass "659.312423" | xref | delta_avge_mass "659.7514" | xref | delta_composition "H(46) C(37) N(3) O(6) P" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2011-05-06 20:03:27" | xref | date_time_modified "2011-05-09 16:01:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Y" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1039] === UNIMOD:1039 Biotin:Thermo-21901+H2O |
null .Term [UNIMOD:1039] [cols="2*"] |
| id | UNIMOD:1039 | name | Biotin:Thermo-21901+H2O | def | "Maleimide-Biotin + Water." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1039] | synonym | "Maleimide-PEG2-Biotin + Water" [] | xref | record_id "1039" | xref | delta_mono_mass "543.236284" | xref | delta_avge_mass "543.6336" | xref | delta_composition "H(37) C(23) N(5) O(8) S" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-05-18 16:28:42" | xref | date_time_modified "2011-05-25 16:02:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1041] === UNIMOD:1041 Deoxyhypusine |
null .Term [UNIMOD:1041] [cols="2*"] |
| id | UNIMOD:1041 | name | Deoxyhypusine | def | "Deoxyhypusine." [PMID:20942800, PMID:10542236, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1041] | comment | Deoxyhypusine synthase catalyzes the formation of a deoxyhypusine by transferring an aminobutyl moiety from spermidine onto a conserved lysine residue within the eIF5A. | xref | record_id "1041" | xref | delta_mono_mass "71.073499" | xref | delta_avge_mass "71.121" | xref | delta_composition "H(9) C(4) N" | xref | username_of_poster "cbarrero" | xref | group_of_poster "" | xref | date_time_posted "2011-06-15 12:04:35" | xref | date_time_modified "2015-01-12 16:03:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "Q" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_2_misc_notes "putrescine Q-PUT" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1042] === UNIMOD:1042 Acetyldeoxyhypusine |
null .Term [UNIMOD:1042] [cols="2*"] |
| id | UNIMOD:1042 | name | Acetyldeoxyhypusine | def | "Acetyldeoxyhypusine." [PMID:20942800, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1042] | comment | Regulation of eIF5A by deoxyhypusine acetylation/deacetylation. | xref | record_id "1042" | xref | delta_mono_mass "97.089149" | xref | delta_avge_mass "97.1582" | xref | delta_composition "H(11) C(6) N" | xref | username_of_poster "cbarrero" | xref | group_of_poster "" | xref | date_time_posted "2011-06-18 04:14:19" | xref | date_time_modified "2011-06-25 03:10:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1043] === UNIMOD:1043 Acetylhypusine |
null .Term [UNIMOD:1043] [cols="2*"] |
| id | UNIMOD:1043 | name | Acetylhypusine | def | "Acetylhypusine." [PMID:20942800, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1043] | comment | Regulation of eIF5A by hypusine acetylation/deacetylation. | xref | record_id "1043" | xref | delta_mono_mass "113.084064" | xref | delta_avge_mass "113.1576" | xref | delta_composition "H(11) C(6) N O" | xref | username_of_poster "cbarrero" | xref | group_of_poster "" | xref | date_time_posted "2011-06-18 04:16:59" | xref | date_time_modified "2011-06-25 03:11:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1044] === UNIMOD:1044 Ala→Cys |
null .Term [UNIMOD:1044] [cols="2*"] |
| id | UNIMOD:1044 | name | Ala→Cys | def | "Ala→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1044] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1044" | xref | delta_mono_mass "31.972071" | xref | delta_avge_mass "32.065" | xref | delta_composition "S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:49:30" | xref | date_time_modified "2011-06-20 16:49:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1045] === UNIMOD:1045 Ala→Phe |
null .Term [UNIMOD:1045] [cols="2*"] |
| id | UNIMOD:1045 | name | Ala→Phe | def | "Ala→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1045] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1045" | xref | delta_mono_mass "76.0313" | xref | delta_avge_mass "76.096" | xref | delta_composition "H(4) C(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:50:25" | xref | date_time_modified "2011-06-20 16:50:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1046] === UNIMOD:1046 Ala→His |
null .Term [UNIMOD:1046] [cols="2*"] |
| id | UNIMOD:1046 | name | Ala→His | def | "Ala→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1046] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1046" | xref | delta_mono_mass "66.021798" | xref | delta_avge_mass "66.0614" | xref | delta_composition "H(2) C(3) N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:56:21" | xref | date_time_modified "2011-06-20 16:56:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1047] === UNIMOD:1047 Ala→Xle |
null .Term [UNIMOD:1047] [cols="2*"] |
| id | UNIMOD:1047 | name | Ala→Xle | def | "Ala→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1047] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1047" | xref | delta_mono_mass "42.04695" | xref | delta_avge_mass "42.0797" | xref | delta_composition "H(6) C(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:57:10" | xref | date_time_modified "2011-06-21 15:12:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1048] === UNIMOD:1048 Ala→Lys |
null .Term [UNIMOD:1048] [cols="2*"] |
| id | UNIMOD:1048 | name | Ala→Lys | def | "Ala→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1048] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1048" | xref | delta_mono_mass "57.057849" | xref | delta_avge_mass "57.0944" | xref | delta_composition "H(7) C(3) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:57:37" | xref | date_time_modified "2011-06-20 16:57:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1049] === UNIMOD:1049 Ala→Met |
null .Term [UNIMOD:1049] [cols="2*"] |
| id | UNIMOD:1049 | name | Ala→Met | def | "Ala→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1049] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1049" | xref | delta_mono_mass "60.003371" | xref | delta_avge_mass "60.1182" | xref | delta_composition "H(4) C(2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:58:05" | xref | date_time_modified "2011-06-20 16:58:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1050] === UNIMOD:1050 Ala→Asn |
null .Term [UNIMOD:1050] [cols="2*"] |
| id | UNIMOD:1050 | name | Ala→Asn | def | "Ala→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1050] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1050" | xref | delta_mono_mass "43.005814" | xref | delta_avge_mass "43.0247" | xref | delta_composition "H C N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:58:32" | xref | date_time_modified "2011-06-20 16:58:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1051] === UNIMOD:1051 Ala→Gln |
null .Term [UNIMOD:1051] [cols="2*"] |
| id | UNIMOD:1051 | name | Ala→Gln | def | "Ala→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1051] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1051" | xref | delta_mono_mass "57.021464" | xref | delta_avge_mass "57.0513" | xref | delta_composition "H(3) C(2) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:58:56" | xref | date_time_modified "2011-06-20 16:58:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1052] === UNIMOD:1052 Ala→Arg |
null .Term [UNIMOD:1052] [cols="2*"] |
| id | UNIMOD:1052 | name | Ala→Arg | def | "Ala→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1052] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1052" | xref | delta_mono_mass "85.063997" | xref | delta_avge_mass "85.1078" | xref | delta_composition "H(7) C(3) N(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:59:22" | xref | date_time_modified "2011-06-20 16:59:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1053] === UNIMOD:1053 Ala→Trp |
null .Term [UNIMOD:1053] [cols="2*"] |
| id | UNIMOD:1053 | name | Ala→Trp | def | "Ala→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1053] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1053" | xref | delta_mono_mass "115.042199" | xref | delta_avge_mass "115.132" | xref | delta_composition "H(5) C(8) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 16:59:45" | xref | date_time_modified "2011-06-20 16:59:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1054] === UNIMOD:1054 Ala→Tyr |
null .Term [UNIMOD:1054] [cols="2*"] |
| id | UNIMOD:1054 | name | Ala→Tyr | def | "Ala→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1054] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1054" | xref | delta_mono_mass "92.026215" | xref | delta_avge_mass "92.0954" | xref | delta_composition "H(4) C(6) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:00:09" | xref | date_time_modified "2011-06-20 17:00:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1055] === UNIMOD:1055 Cys→Ala |
null .Term [UNIMOD:1055] [cols="2*"] |
| id | UNIMOD:1055 | name | Cys→Ala | def | "Cys→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1055] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1055" | xref | delta_mono_mass "-31.972071" | xref | delta_avge_mass "-32.065" | xref | delta_composition "S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:26:22" | xref | date_time_modified "2011-06-20 17:26:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1056] === UNIMOD:1056 Cys→Asp |
null .Term [UNIMOD:1056] [cols="2*"] |
| id | UNIMOD:1056 | name | Cys→Asp | def | "Cys→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1056] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1056" | xref | delta_mono_mass "12.017759" | xref | delta_avge_mass "11.9445" | xref | delta_composition "C O(2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:26:57" | xref | date_time_modified "2011-06-20 17:26:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1057] === UNIMOD:1057 Cys→Glu |
null .Term [UNIMOD:1057] [cols="2*"] |
| id | UNIMOD:1057 | name | Cys→Glu | def | "Cys→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1057] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1057" | xref | delta_mono_mass "26.033409" | xref | delta_avge_mass "25.9711" | xref | delta_composition "H(2) C(2) O(2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:27:25" | xref | date_time_modified "2011-06-20 17:27:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1058] === UNIMOD:1058 Cys→His |
null .Term [UNIMOD:1058] [cols="2*"] |
| id | UNIMOD:1058 | name | Cys→His | def | "Cys→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1058] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1058" | xref | delta_mono_mass "34.049727" | xref | delta_avge_mass "33.9964" | xref | delta_composition "H(2) C(3) N(2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:27:48" | xref | date_time_modified "2011-06-20 17:27:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1059] === UNIMOD:1059 Cys→Xle |
null .Term [UNIMOD:1059] [cols="2*"] |
| id | UNIMOD:1059 | name | Cys→Xle | def | "Cys→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1059] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1059" | xref | delta_mono_mass "10.07488" | xref | delta_avge_mass "10.0147" | xref | delta_composition "H(6) C(3) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:28:11" | xref | date_time_modified "2011-06-21 15:14:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1060] === UNIMOD:1060 Cys→Lys |
null .Term [UNIMOD:1060] [cols="2*"] |
| id | UNIMOD:1060 | name | Cys→Lys | def | "Cys→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1060] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1060" | xref | delta_mono_mass "25.085779" | xref | delta_avge_mass "25.0294" | xref | delta_composition "H(7) C(3) N S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:28:36" | xref | date_time_modified "2011-06-20 17:28:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1061] === UNIMOD:1061 Cys→Met |
null .Term [UNIMOD:1061] [cols="2*"] |
| id | UNIMOD:1061 | name | Cys→Met | def | "Cys→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1061] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1061" | xref | delta_mono_mass "28.0313" | xref | delta_avge_mass "28.0532" | xref | delta_composition "H(4) C(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:29:04" | xref | date_time_modified "2011-06-20 17:29:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1062] === UNIMOD:1062 Cys→Asn |
null .Term [UNIMOD:1062] [cols="2*"] |
| id | UNIMOD:1062 | name | Cys→Asn | def | "Cys→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1062] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1062" | xref | delta_mono_mass "11.033743" | xref | delta_avge_mass "10.9597" | xref | delta_composition "H C N O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:29:28" | xref | date_time_modified "2011-06-20 17:29:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1063] === UNIMOD:1063 Cys→Pro |
null .Term [UNIMOD:1063] [cols="2*"] |
| id | UNIMOD:1063 | name | Cys→Pro | def | "Cys→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1063] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1063" | xref | delta_mono_mass "-5.956421" | xref | delta_avge_mass "-6.0277" | xref | delta_composition "H(2) C(2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:29:55" | xref | date_time_modified "2011-06-20 17:29:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1064] === UNIMOD:1064 Cys→Gln |
null .Term [UNIMOD:1064] [cols="2*"] |
| id | UNIMOD:1064 | name | Cys→Gln | def | "Cys→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1064] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1064" | xref | delta_mono_mass "25.049393" | xref | delta_avge_mass "24.9863" | xref | delta_composition "H(3) C(2) N O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:30:19" | xref | date_time_modified "2011-06-20 17:30:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1065] === UNIMOD:1065 Cys→Thr |
null .Term [UNIMOD:1065] [cols="2*"] |
| id | UNIMOD:1065 | name | Cys→Thr | def | "Cys→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1065] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1065" | xref | delta_mono_mass "-1.961506" | xref | delta_avge_mass "-2.039" | xref | delta_composition "H(2) C O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:30:53" | xref | date_time_modified "2011-06-20 17:30:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1066] === UNIMOD:1066 Cys→Val |
null .Term [UNIMOD:1066] [cols="2*"] |
| id | UNIMOD:1066 | name | Cys→Val | def | "Cys→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1066] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1066" | xref | delta_mono_mass "-3.940771" | xref | delta_avge_mass "-4.0118" | xref | delta_composition "H(4) C(2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:31:23" | xref | date_time_modified "2011-06-20 17:31:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1067] === UNIMOD:1067 Asp→Cys |
null .Term [UNIMOD:1067] [cols="2*"] |
| id | UNIMOD:1067 | name | Asp→Cys | def | "Asp→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1067] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1067" | xref | delta_mono_mass "-12.017759" | xref | delta_avge_mass "-11.9445" | xref | delta_composition "C(-1) O(-2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:40:11" | xref | date_time_modified "2011-06-20 17:40:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1068] === UNIMOD:1068 Asp→Phe |
null .Term [UNIMOD:1068] [cols="2*"] |
| id | UNIMOD:1068 | name | Asp→Phe | def | "Asp→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1068] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1068" | xref | delta_mono_mass "32.041471" | xref | delta_avge_mass "32.0865" | xref | delta_composition "H(4) C(5) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:40:35" | xref | date_time_modified "2011-06-20 17:40:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1069] === UNIMOD:1069 Asp→Xle |
null .Term [UNIMOD:1069] [cols="2*"] |
| id | UNIMOD:1069 | name | Asp→Xle | def | "Asp→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1069] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1069" | xref | delta_mono_mass "-1.942879" | xref | delta_avge_mass "-1.9298" | xref | delta_composition "H(6) C(2) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:41:00" | xref | date_time_modified "2011-06-21 15:14:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1070] === UNIMOD:1070 Asp→Lys |
null .Term [UNIMOD:1070] [cols="2*"] |
| id | UNIMOD:1070 | name | Asp→Lys | def | "Asp→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1070] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1070" | xref | delta_mono_mass "13.06802" | xref | delta_avge_mass "13.0849" | xref | delta_composition "H(7) C(2) N O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:41:26" | xref | date_time_modified "2011-06-20 17:41:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1071] === UNIMOD:1071 Asp→Met |
null .Term [UNIMOD:1071] [cols="2*"] |
| id | UNIMOD:1071 | name | Asp→Met | def | "Asp→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1071] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1071" | xref | delta_mono_mass "16.013542" | xref | delta_avge_mass "16.1087" | xref | delta_composition "H(4) C O(-2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:41:51" | xref | date_time_modified "2011-06-20 17:41:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1072] === UNIMOD:1072 Asp→Pro |
null .Term [UNIMOD:1072] [cols="2*"] |
| id | UNIMOD:1072 | name | Asp→Pro | def | "Asp→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1072] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1072" | xref | delta_mono_mass "-17.974179" | xref | delta_avge_mass "-17.9722" | xref | delta_composition "H(2) C O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:42:17" | xref | date_time_modified "2011-06-20 17:42:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1073] === UNIMOD:1073 Asp→Gln |
null .Term [UNIMOD:1073] [cols="2*"] |
| id | UNIMOD:1073 | name | Asp→Gln | def | "Asp→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1073] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1073" | xref | delta_mono_mass "13.031634" | xref | delta_avge_mass "13.0418" | xref | delta_composition "H(3) C N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:42:41" | xref | date_time_modified "2011-06-20 17:42:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1074] === UNIMOD:1074 Asp→Arg |
null .Term [UNIMOD:1074] [cols="2*"] |
| id | UNIMOD:1074 | name | Asp→Arg | def | "Asp→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1074] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1074" | xref | delta_mono_mass "41.074168" | xref | delta_avge_mass "41.0983" | xref | delta_composition "H(7) C(2) N(3) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:43:03" | xref | date_time_modified "2011-06-20 17:43:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1075] === UNIMOD:1075 Asp→Ser |
null .Term [UNIMOD:1075] [cols="2*"] |
| id | UNIMOD:1075 | name | Asp→Ser | def | "Asp→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1075] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1075" | xref | delta_mono_mass "-27.994915" | xref | delta_avge_mass "-28.0101" | xref | delta_composition "C(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:43:25" | xref | date_time_modified "2011-06-20 17:43:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1076] === UNIMOD:1076 Asp→Thr |
null .Term [UNIMOD:1076] [cols="2*"] |
| id | UNIMOD:1076 | name | Asp→Thr | def | "Asp→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1076] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1076" | xref | delta_mono_mass "-13.979265" | xref | delta_avge_mass "-13.9835" | xref | delta_composition "H(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:43:51" | xref | date_time_modified "2011-06-20 17:43:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1077] === UNIMOD:1077 Asp→Trp |
null .Term [UNIMOD:1077] [cols="2*"] |
| id | UNIMOD:1077 | name | Asp→Trp | def | "Asp→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1077] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1077" | xref | delta_mono_mass "71.05237" | xref | delta_avge_mass "71.1225" | xref | delta_composition "H(5) C(7) N O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-20 17:44:16" | xref | date_time_modified "2011-06-20 17:44:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1078] === UNIMOD:1078 Glu→Cys |
null .Term [UNIMOD:1078] [cols="2*"] |
| id | UNIMOD:1078 | name | Glu→Cys | def | "Glu→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1078] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1078" | xref | delta_mono_mass "-26.033409" | xref | delta_avge_mass "-25.9711" | xref | delta_composition "H(-2) C(-2) O(-2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:00:46" | xref | date_time_modified "2011-06-21 12:00:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1079] === UNIMOD:1079 Glu→Phe |
null .Term [UNIMOD:1079] [cols="2*"] |
| id | UNIMOD:1079 | name | Glu→Phe | def | "Glu→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1079] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1079" | xref | delta_mono_mass "18.025821" | xref | delta_avge_mass "18.0599" | xref | delta_composition "H(2) C(4) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:01:12" | xref | date_time_modified "2011-06-21 12:01:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1080] === UNIMOD:1080 Glu→His |
null .Term [UNIMOD:1080] [cols="2*"] |
| id | UNIMOD:1080 | name | Glu→His | def | "Glu→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1080] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1080" | xref | delta_mono_mass "8.016319" | xref | delta_avge_mass "8.0253" | xref | delta_composition "C N(2) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:01:42" | xref | date_time_modified "2011-06-21 12:01:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1081] === UNIMOD:1081 Glu→Xle |
null .Term [UNIMOD:1081] [cols="2*"] |
| id | UNIMOD:1081 | name | Glu→Xle | def | "Glu→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1081] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1081" | xref | delta_mono_mass "-15.958529" | xref | delta_avge_mass "-15.9563" | xref | delta_composition "H(4) C O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:02:09" | xref | date_time_modified "2011-06-21 15:15:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1082] === UNIMOD:1082 Glu→Met |
null .Term [UNIMOD:1082] [cols="2*"] |
| id | UNIMOD:1082 | name | Glu→Met | def | "Glu→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1082] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1082" | xref | delta_mono_mass "1.997892" | xref | delta_avge_mass "2.0821" | xref | delta_composition "H(2) O(-2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:02:35" | xref | date_time_modified "2011-06-21 12:02:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1083] === UNIMOD:1083 Glu→Asn |
null .Term [UNIMOD:1083] [cols="2*"] |
| id | UNIMOD:1083 | name | Glu→Asn | def | "Glu→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1083] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1083" | xref | delta_mono_mass "-14.999666" | xref | delta_avge_mass "-15.0113" | xref | delta_composition "H(-1) C(-1) N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:03:01" | xref | date_time_modified "2011-06-21 12:03:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1084] === UNIMOD:1084 Glu→Pro |
null .Term [UNIMOD:1084] [cols="2*"] |
| id | UNIMOD:1084 | name | Glu→Pro | def | "Glu→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1084] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1084" | xref | delta_mono_mass "-31.989829" | xref | delta_avge_mass "-31.9988" | xref | delta_composition "O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:03:25" | xref | date_time_modified "2011-06-21 12:03:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1085] === UNIMOD:1085 Glu→Arg |
null .Term [UNIMOD:1085] [cols="2*"] |
| id | UNIMOD:1085 | name | Glu→Arg | def | "Glu→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1085] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1085" | xref | delta_mono_mass "27.058518" | xref | delta_avge_mass "27.0717" | xref | delta_composition "H(5) C N(3) O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:03:48" | xref | date_time_modified "2011-06-21 12:03:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1086] === UNIMOD:1086 Glu→Ser |
null .Term [UNIMOD:1086] [cols="2*"] |
| id | UNIMOD:1086 | name | Glu→Ser | def | "Glu→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1086] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1086" | xref | delta_mono_mass "-42.010565" | xref | delta_avge_mass "-42.0367" | xref | delta_composition "H(-2) C(-2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:04:12" | xref | date_time_modified "2011-06-21 12:04:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1087] === UNIMOD:1087 Glu→Thr |
null .Term [UNIMOD:1087] [cols="2*"] |
| id | UNIMOD:1087 | name | Glu→Thr | def | "Glu→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1087] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1087" | xref | delta_mono_mass "-27.994915" | xref | delta_avge_mass "-28.0101" | xref | delta_composition "C(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:04:38" | xref | date_time_modified "2011-06-21 12:04:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1088] === UNIMOD:1088 Glu→Trp |
null .Term [UNIMOD:1088] [cols="2*"] |
| id | UNIMOD:1088 | name | Glu→Trp | def | "Glu→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1088] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1088" | xref | delta_mono_mass "57.03672" | xref | delta_avge_mass "57.0959" | xref | delta_composition "H(3) C(6) N O(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:05:01" | xref | date_time_modified "2011-06-21 12:05:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1089] === UNIMOD:1089 Glu→Tyr |
null .Term [UNIMOD:1089] [cols="2*"] |
| id | UNIMOD:1089 | name | Glu→Tyr | def | "Glu→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1089] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1089" | xref | delta_mono_mass "34.020735" | xref | delta_avge_mass "34.0593" | xref | delta_composition "H(2) C(4) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 12:05:23" | xref | date_time_modified "2011-06-21 12:05:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1090] === UNIMOD:1090 Phe→Ala |
null .Term [UNIMOD:1090] [cols="2*"] |
| id | UNIMOD:1090 | name | Phe→Ala | def | "Phe→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1090] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1090" | xref | delta_mono_mass "-76.0313" | xref | delta_avge_mass "-76.096" | xref | delta_composition "H(-4) C(-6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:41:15" | xref | date_time_modified "2011-06-21 13:41:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1091] === UNIMOD:1091 Phe→Asp |
null .Term [UNIMOD:1091] [cols="2*"] |
| id | UNIMOD:1091 | name | Phe→Asp | def | "Phe→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1091] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1091" | xref | delta_mono_mass "-32.041471" | xref | delta_avge_mass "-32.0865" | xref | delta_composition "H(-4) C(-5) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:41:48" | xref | date_time_modified "2011-06-21 13:41:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1092] === UNIMOD:1092 Phe→Glu |
null .Term [UNIMOD:1092] [cols="2*"] |
| id | UNIMOD:1092 | name | Phe→Glu | def | "Phe→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1092] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1092" | xref | delta_mono_mass "-18.025821" | xref | delta_avge_mass "-18.0599" | xref | delta_composition "H(-2) C(-4) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:56:57" | xref | date_time_modified "2011-06-21 13:56:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1093] === UNIMOD:1093 Phe→Gly |
null .Term [UNIMOD:1093] [cols="2*"] |
| id | UNIMOD:1093 | name | Phe→Gly | def | "Phe→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1093] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1093" | xref | delta_mono_mass "-90.04695" | xref | delta_avge_mass "-90.1225" | xref | delta_composition "H(-6) C(-7)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:57:23" | xref | date_time_modified "2011-06-21 13:57:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1094] === UNIMOD:1094 Phe→His |
null .Term [UNIMOD:1094] [cols="2*"] |
| id | UNIMOD:1094 | name | Phe→His | def | "Phe→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1094] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1094" | xref | delta_mono_mass "-10.009502" | xref | delta_avge_mass "-10.0346" | xref | delta_composition "H(-2) C(-3) N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:57:45" | xref | date_time_modified "2011-06-21 13:57:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1095] === UNIMOD:1095 Phe→Lys |
null .Term [UNIMOD:1095] [cols="2*"] |
| id | UNIMOD:1095 | name | Phe→Lys | def | "Phe→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1095] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1095" | xref | delta_mono_mass "-18.973451" | xref | delta_avge_mass "-19.0016" | xref | delta_composition "H(3) C(-3) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:58:10" | xref | date_time_modified "2011-06-21 13:58:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1096] === UNIMOD:1096 Phe→Met |
null .Term [UNIMOD:1096] [cols="2*"] |
| id | UNIMOD:1096 | name | Phe→Met | def | "Phe→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1096] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1096" | xref | delta_mono_mass "-16.027929" | xref | delta_avge_mass "-15.9778" | xref | delta_composition "C(-4) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:58:32" | xref | date_time_modified "2011-06-21 13:58:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1097] === UNIMOD:1097 Phe→Asn |
null .Term [UNIMOD:1097] [cols="2*"] |
| id | UNIMOD:1097 | name | Phe→Asn | def | "Phe→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1097] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1097" | xref | delta_mono_mass "-33.025486" | xref | delta_avge_mass "-33.0712" | xref | delta_composition "H(-3) C(-5) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:58:57" | xref | date_time_modified "2011-06-21 13:58:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1098] === UNIMOD:1098 Phe→Pro |
null .Term [UNIMOD:1098] [cols="2*"] |
| id | UNIMOD:1098 | name | Phe→Pro | def | "Phe→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1098] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1098" | xref | delta_mono_mass "-50.01565" | xref | delta_avge_mass "-50.0587" | xref | delta_composition "H(-2) C(-4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:59:19" | xref | date_time_modified "2011-06-21 13:59:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1099] === UNIMOD:1099 Phe→Gln |
null .Term [UNIMOD:1099] [cols="2*"] |
| id | UNIMOD:1099 | name | Phe→Gln | def | "Phe→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1099] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1099" | xref | delta_mono_mass "-19.009836" | xref | delta_avge_mass "-19.0446" | xref | delta_composition "H(-1) C(-4) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 13:59:42" | xref | date_time_modified "2011-06-21 13:59:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1100] === UNIMOD:1100 Phe→Arg |
null .Term [UNIMOD:1100] [cols="2*"] |
| id | UNIMOD:1100 | name | Phe→Arg | def | "Phe→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1100] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1100" | xref | delta_mono_mass "9.032697" | xref | delta_avge_mass "9.0118" | xref | delta_composition "H(3) C(-3) N(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:00:05" | xref | date_time_modified "2011-06-21 14:00:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1101] === UNIMOD:1101 Phe→Thr |
null .Term [UNIMOD:1101] [cols="2*"] |
| id | UNIMOD:1101 | name | Phe→Thr | def | "Phe→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1101] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1101" | xref | delta_mono_mass "-46.020735" | xref | delta_avge_mass "-46.07" | xref | delta_composition "H(-2) C(-5) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:00:30" | xref | date_time_modified "2011-06-21 14:00:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1102] === UNIMOD:1102 Phe→Trp |
null .Term [UNIMOD:1102] [cols="2*"] |
| id | UNIMOD:1102 | name | Phe→Trp | def | "Phe→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1102] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1102" | xref | delta_mono_mass "39.010899" | xref | delta_avge_mass "39.036" | xref | delta_composition "H C(2) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:00:53" | xref | date_time_modified "2011-06-21 14:00:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1103] === UNIMOD:1103 Gly→Phe |
null .Term [UNIMOD:1103] [cols="2*"] |
| id | UNIMOD:1103 | name | Gly→Phe | def | "Gly→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1103] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1103" | xref | delta_mono_mass "90.04695" | xref | delta_avge_mass "90.1225" | xref | delta_composition "H(6) C(7)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:03:41" | xref | date_time_modified "2011-06-21 14:03:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1104] === UNIMOD:1104 Gly→His |
null .Term [UNIMOD:1104] [cols="2*"] |
| id | UNIMOD:1104 | name | Gly→His | def | "Gly→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1104] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1104" | xref | delta_mono_mass "80.037448" | xref | delta_avge_mass "80.088" | xref | delta_composition "H(4) C(4) N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:04:05" | xref | date_time_modified "2011-06-21 14:04:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1105] === UNIMOD:1105 Gly→Xle |
null .Term [UNIMOD:1105] [cols="2*"] |
| id | UNIMOD:1105 | name | Gly→Xle | def | "Gly→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1105] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1105" | xref | delta_mono_mass "56.0626" | xref | delta_avge_mass "56.1063" | xref | delta_composition "H(8) C(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:04:27" | xref | date_time_modified "2011-06-21 15:15:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1106] === UNIMOD:1106 Gly→Lys |
null .Term [UNIMOD:1106] [cols="2*"] |
| id | UNIMOD:1106 | name | Gly→Lys | def | "Gly→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1106] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1106" | xref | delta_mono_mass "71.073499" | xref | delta_avge_mass "71.121" | xref | delta_composition "H(9) C(4) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:04:51" | xref | date_time_modified "2011-06-21 14:04:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1107] === UNIMOD:1107 Gly→Met |
null .Term [UNIMOD:1107] [cols="2*"] |
| id | UNIMOD:1107 | name | Gly→Met | def | "Gly→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1107] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1107" | xref | delta_mono_mass "74.019021" | xref | delta_avge_mass "74.1447" | xref | delta_composition "H(6) C(3) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:05:16" | xref | date_time_modified "2011-06-21 14:05:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1108] === UNIMOD:1108 Gly→Asn |
null .Term [UNIMOD:1108] [cols="2*"] |
| id | UNIMOD:1108 | name | Gly→Asn | def | "Gly→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1108] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1108" | xref | delta_mono_mass "57.021464" | xref | delta_avge_mass "57.0513" | xref | delta_composition "H(3) C(2) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:05:35" | xref | date_time_modified "2011-06-21 14:05:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1109] === UNIMOD:1109 Gly→Pro |
null .Term [UNIMOD:1109] [cols="2*"] |
| id | UNIMOD:1109 | name | Gly→Pro | def | "Gly→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1109] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1109" | xref | delta_mono_mass "40.0313" | xref | delta_avge_mass "40.0639" | xref | delta_composition "H(4) C(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:05:55" | xref | date_time_modified "2011-06-21 14:05:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1110] === UNIMOD:1110 Gly→Gln |
null .Term [UNIMOD:1110] [cols="2*"] |
| id | UNIMOD:1110 | name | Gly→Gln | def | "Gly→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1110] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1110" | xref | delta_mono_mass "71.037114" | xref | delta_avge_mass "71.0779" | xref | delta_composition "H(5) C(3) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:06:16" | xref | date_time_modified "2011-06-21 14:06:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1111] === UNIMOD:1111 Gly→Thr |
null .Term [UNIMOD:1111] [cols="2*"] |
| id | UNIMOD:1111 | name | Gly→Thr | def | "Gly→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1111] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1111" | xref | delta_mono_mass "44.026215" | xref | delta_avge_mass "44.0526" | xref | delta_composition "H(4) C(2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:06:40" | xref | date_time_modified "2011-06-21 14:06:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1112] === UNIMOD:1112 Gly→Tyr |
null .Term [UNIMOD:1112] [cols="2*"] |
| id | UNIMOD:1112 | name | Gly→Tyr | def | "Gly→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1112] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1112" | xref | delta_mono_mass "106.041865" | xref | delta_avge_mass "106.1219" | xref | delta_composition "H(6) C(7) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:07:05" | xref | date_time_modified "2011-06-21 14:07:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "G" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1113] === UNIMOD:1113 His→Ala |
null .Term [UNIMOD:1113] [cols="2*"] |
| id | UNIMOD:1113 | name | His→Ala | def | "His→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1113] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1113" | xref | delta_mono_mass "-66.021798" | xref | delta_avge_mass "-66.0614" | xref | delta_composition "H(-2) C(-3) N(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:51:31" | xref | date_time_modified "2011-06-21 14:51:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1114] === UNIMOD:1114 His→Cys |
null .Term [UNIMOD:1114] [cols="2*"] |
| id | UNIMOD:1114 | name | His→Cys | def | "His→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1114] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1114" | xref | delta_mono_mass "-34.049727" | xref | delta_avge_mass "-33.9964" | xref | delta_composition "H(-2) C(-3) N(-2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:51:56" | xref | date_time_modified "2011-06-21 14:51:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1115] === UNIMOD:1115 His→Glu |
null .Term [UNIMOD:1115] [cols="2*"] |
| id | UNIMOD:1115 | name | His→Glu | def | "His→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1115] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1115" | xref | delta_mono_mass "-8.016319" | xref | delta_avge_mass "-8.0253" | xref | delta_composition "C(-1) N(-2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:52:16" | xref | date_time_modified "2011-06-21 14:52:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1116] === UNIMOD:1116 His→Phe |
null .Term [UNIMOD:1116] [cols="2*"] |
| id | UNIMOD:1116 | name | His→Phe | def | "His→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1116] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1116" | xref | delta_mono_mass "10.009502" | xref | delta_avge_mass "10.0346" | xref | delta_composition "H(2) C(3) N(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:52:50" | xref | date_time_modified "2011-06-21 14:52:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1117] === UNIMOD:1117 His→Gly |
null .Term [UNIMOD:1117] [cols="2*"] |
| id | UNIMOD:1117 | name | His→Gly | def | "His→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1117] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1117" | xref | delta_mono_mass "-80.037448" | xref | delta_avge_mass "-80.088" | xref | delta_composition "H(-4) C(-4) N(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:53:45" | xref | date_time_modified "2011-06-21 14:53:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1119] === UNIMOD:1119 His→Lys |
null .Term [UNIMOD:1119] [cols="2*"] |
| id | UNIMOD:1119 | name | His→Lys | def | "His→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1119] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1119" | xref | delta_mono_mass "-8.963949" | xref | delta_avge_mass "-8.967" | xref | delta_composition "H(5) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:59:08" | xref | date_time_modified "2011-06-21 14:59:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1120] === UNIMOD:1120 His→Met |
null .Term [UNIMOD:1120] [cols="2*"] |
| id | UNIMOD:1120 | name | His→Met | def | "His→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1120] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1120" | xref | delta_mono_mass "-6.018427" | xref | delta_avge_mass "-5.9432" | xref | delta_composition "H(2) C(-1) N(-2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:59:30" | xref | date_time_modified "2011-06-21 14:59:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1121] === UNIMOD:1121 His→Ser |
null .Term [UNIMOD:1121] [cols="2*"] |
| id | UNIMOD:1121 | name | His→Ser | def | "His→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1121] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1121" | xref | delta_mono_mass "-50.026883" | xref | delta_avge_mass "-50.062" | xref | delta_composition "H(-2) C(-3) N(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 14:59:50" | xref | date_time_modified "2011-06-21 14:59:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1122] === UNIMOD:1122 His→Thr |
null .Term [UNIMOD:1122] [cols="2*"] |
| id | UNIMOD:1122 | name | His→Thr | def | "His→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1122] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1122" | xref | delta_mono_mass "-36.011233" | xref | delta_avge_mass "-36.0354" | xref | delta_composition "C(-2) N(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:00:20" | xref | date_time_modified "2011-06-21 15:00:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1123] === UNIMOD:1123 His→Val |
null .Term [UNIMOD:1123] [cols="2*"] |
| id | UNIMOD:1123 | name | His→Val | def | "His→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1123] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1123" | xref | delta_mono_mass "-37.990498" | xref | delta_avge_mass "-38.0082" | xref | delta_composition "H(2) C(-1) N(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:00:41" | xref | date_time_modified "2011-06-21 15:00:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1124] === UNIMOD:1124 His→Trp |
null .Term [UNIMOD:1124] [cols="2*"] |
| id | UNIMOD:1124 | name | His→Trp | def | "His→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1124] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1124" | xref | delta_mono_mass "49.020401" | xref | delta_avge_mass "49.0706" | xref | delta_composition "H(3) C(5) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:01:02" | xref | date_time_modified "2011-06-21 15:01:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1125] === UNIMOD:1125 Xle→Ala |
null .Term [UNIMOD:1125] [cols="2*"] |
| id | UNIMOD:1125 | name | Xle→Ala | def | "Leu/Ile→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1125] | xref | record_id "1125" | xref | delta_mono_mass "-42.04695" | xref | delta_avge_mass "-42.0797" | xref | delta_composition "H(-6) C(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:33:19" | xref | date_time_modified "2011-06-21 15:33:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1126] === UNIMOD:1126 Xle→Cys |
null .Term [UNIMOD:1126] [cols="2*"] |
| id | UNIMOD:1126 | name | Xle→Cys | def | "Leu/Ile→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1126] | xref | record_id "1126" | xref | delta_mono_mass "-10.07488" | xref | delta_avge_mass "-10.0147" | xref | delta_composition "H(-6) C(-3) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:33:43" | xref | date_time_modified "2011-06-21 15:33:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1127] === UNIMOD:1127 Xle→Asp |
null .Term [UNIMOD:1127] [cols="2*"] |
| id | UNIMOD:1127 | name | Xle→Asp | def | "Leu/Ile→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1127] | xref | record_id "1127" | xref | delta_mono_mass "1.942879" | xref | delta_avge_mass "1.9298" | xref | delta_composition "H(-6) C(-2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:34:14" | xref | date_time_modified "2011-06-21 15:34:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1128] === UNIMOD:1128 Xle→Glu |
null .Term [UNIMOD:1128] [cols="2*"] |
| id | UNIMOD:1128 | name | Xle→Glu | def | "Leu/Ile→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1128] | xref | record_id "1128" | xref | delta_mono_mass "15.958529" | xref | delta_avge_mass "15.9563" | xref | delta_composition "H(-4) C(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:34:40" | xref | date_time_modified "2011-06-21 15:34:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1129] === UNIMOD:1129 Xle→Gly |
null .Term [UNIMOD:1129] [cols="2*"] |
| id | UNIMOD:1129 | name | Xle→Gly | def | "Leu/Ile→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1129] | xref | record_id "1129" | xref | delta_mono_mass "-56.0626" | xref | delta_avge_mass "-56.1063" | xref | delta_composition "H(-8) C(-4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:35:12" | xref | date_time_modified "2011-06-21 15:35:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1130] === UNIMOD:1130 Xle→Tyr |
null .Term [UNIMOD:1130] [cols="2*"] |
| id | UNIMOD:1130 | name | Xle→Tyr | def | "Leu/Ile→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1130] | xref | record_id "1130" | xref | delta_mono_mass "49.979265" | xref | delta_avge_mass "50.0156" | xref | delta_composition "H(-2) C(3) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:35:36" | xref | date_time_modified "2011-06-21 15:35:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "I" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1131] === UNIMOD:1131 Lys→Ala |
null .Term [UNIMOD:1131] [cols="2*"] |
| id | UNIMOD:1131 | name | Lys→Ala | def | "Lys→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1131] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1131" | xref | delta_mono_mass "-57.057849" | xref | delta_avge_mass "-57.0944" | xref | delta_composition "H(-7) C(-3) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 15:37:25" | xref | date_time_modified "2011-06-21 15:37:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1132] === UNIMOD:1132 Lys→Cys |
null .Term [UNIMOD:1132] [cols="2*"] |
| id | UNIMOD:1132 | name | Lys→Cys | def | "Lys→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1132] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1132" | xref | delta_mono_mass "-25.085779" | xref | delta_avge_mass "-25.0294" | xref | delta_composition "H(-7) C(-3) N(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:01:01" | xref | date_time_modified "2011-06-21 16:01:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1133] === UNIMOD:1133 Lys→Asp |
null .Term [UNIMOD:1133] [cols="2*"] |
| id | UNIMOD:1133 | name | Lys→Asp | def | "Lys→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1133] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1133" | xref | delta_mono_mass "-13.06802" | xref | delta_avge_mass "-13.0849" | xref | delta_composition "H(-7) C(-2) N(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:01:33" | xref | date_time_modified "2011-06-21 16:01:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1134] === UNIMOD:1134 Lys→Phe |
null .Term [UNIMOD:1134] [cols="2*"] |
| id | UNIMOD:1134 | name | Lys→Phe | def | "Lys→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1134] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1134" | xref | delta_mono_mass "18.973451" | xref | delta_avge_mass "19.0016" | xref | delta_composition "H(-3) C(3) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:01:56" | xref | date_time_modified "2011-06-21 16:01:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1135] === UNIMOD:1135 Lys→Gly |
null .Term [UNIMOD:1135] [cols="2*"] |
| id | UNIMOD:1135 | name | Lys→Gly | def | "Lys→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1135] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1135" | xref | delta_mono_mass "-71.073499" | xref | delta_avge_mass "-71.121" | xref | delta_composition "H(-9) C(-4) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:02:20" | xref | date_time_modified "2011-06-21 16:02:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1136] === UNIMOD:1136 Lys→His |
null .Term [UNIMOD:1136] [cols="2*"] |
| id | UNIMOD:1136 | name | Lys→His | def | "Lys→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1136] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1136" | xref | delta_mono_mass "8.963949" | xref | delta_avge_mass "8.967" | xref | delta_composition "H(-5) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:02:42" | xref | date_time_modified "2011-06-21 16:02:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1137] === UNIMOD:1137 Lys→Pro |
null .Term [UNIMOD:1137] [cols="2*"] |
| id | UNIMOD:1137 | name | Lys→Pro | def | "Lys→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1137] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1137" | xref | delta_mono_mass "-31.042199" | xref | delta_avge_mass "-31.0571" | xref | delta_composition "H(-5) C(-1) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:03:06" | xref | date_time_modified "2011-06-21 16:03:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1138] === UNIMOD:1138 Lys→Ser |
null .Term [UNIMOD:1138] [cols="2*"] |
| id | UNIMOD:1138 | name | Lys→Ser | def | "Lys→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1138] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1138" | xref | delta_mono_mass "-41.062935" | xref | delta_avge_mass "-41.095" | xref | delta_composition "H(-7) C(-3) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:03:27" | xref | date_time_modified "2011-06-21 16:03:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1139] === UNIMOD:1139 Lys→Val |
null .Term [UNIMOD:1139] [cols="2*"] |
| id | UNIMOD:1139 | name | Lys→Val | def | "Lys→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1139] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1139" | xref | delta_mono_mass "-29.026549" | xref | delta_avge_mass "-29.0412" | xref | delta_composition "H(-3) C(-1) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:03:49" | xref | date_time_modified "2011-06-21 16:03:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1140] === UNIMOD:1140 Lys→Trp |
null .Term [UNIMOD:1140] [cols="2*"] |
| id | UNIMOD:1140 | name | Lys→Trp | def | "Lys→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1140] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1140" | xref | delta_mono_mass "57.98435" | xref | delta_avge_mass "58.0376" | xref | delta_composition "H(-2) C(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:04:11" | xref | date_time_modified "2011-06-21 16:04:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1141] === UNIMOD:1141 Lys→Tyr |
null .Term [UNIMOD:1141] [cols="2*"] |
| id | UNIMOD:1141 | name | Lys→Tyr | def | "Lys→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1141] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1141" | xref | delta_mono_mass "34.968366" | xref | delta_avge_mass "35.001" | xref | delta_composition "H(-3) C(3) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:04:35" | xref | date_time_modified "2011-06-21 16:04:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1142] === UNIMOD:1142 Met→Ala |
null .Term [UNIMOD:1142] [cols="2*"] |
| id | UNIMOD:1142 | name | Met→Ala | def | "Met→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1142] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1142" | xref | delta_mono_mass "-60.003371" | xref | delta_avge_mass "-60.1182" | xref | delta_composition "H(-4) C(-2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:28:27" | xref | date_time_modified "2011-06-21 16:28:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1143] === UNIMOD:1143 Met→Cys |
null .Term [UNIMOD:1143] [cols="2*"] |
| id | UNIMOD:1143 | name | Met→Cys | def | "Met→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1143] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1143" | xref | delta_mono_mass "-28.0313" | xref | delta_avge_mass "-28.0532" | xref | delta_composition "H(-4) C(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:28:53" | xref | date_time_modified "2011-06-21 16:28:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1144] === UNIMOD:1144 Met→Asp |
null .Term [UNIMOD:1144] [cols="2*"] |
| id | UNIMOD:1144 | name | Met→Asp | def | "Met→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1144] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1144" | xref | delta_mono_mass "-16.013542" | xref | delta_avge_mass "-16.1087" | xref | delta_composition "H(-4) C(-1) O(2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:29:13" | xref | date_time_modified "2011-06-21 16:29:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1145] === UNIMOD:1145 Met→Glu |
null .Term [UNIMOD:1145] [cols="2*"] |
| id | UNIMOD:1145 | name | Met→Glu | def | "Met→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1145] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1145" | xref | delta_mono_mass "-1.997892" | xref | delta_avge_mass "-2.0821" | xref | delta_composition "H(-2) O(2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:29:35" | xref | date_time_modified "2011-06-21 16:29:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1146] === UNIMOD:1146 Met→Phe |
null .Term [UNIMOD:1146] [cols="2*"] |
| id | UNIMOD:1146 | name | Met→Phe | def | "Met→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1146] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1146" | xref | delta_mono_mass "16.027929" | xref | delta_avge_mass "15.9778" | xref | delta_composition "C(4) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:30:07" | xref | date_time_modified "2011-06-21 16:30:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1147] === UNIMOD:1147 Met→Gly |
null .Term [UNIMOD:1147] [cols="2*"] |
| id | UNIMOD:1147 | name | Met→Gly | def | "Met→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1147] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1147" | xref | delta_mono_mass "-74.019021" | xref | delta_avge_mass "-74.1447" | xref | delta_composition "H(-6) C(-3) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:30:29" | xref | date_time_modified "2011-06-21 16:30:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1148] === UNIMOD:1148 Met→His |
null .Term [UNIMOD:1148] [cols="2*"] |
| id | UNIMOD:1148 | name | Met→His | def | "Met→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1148] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1148" | xref | delta_mono_mass "6.018427" | xref | delta_avge_mass "5.9432" | xref | delta_composition "H(-2) C N(2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:30:50" | xref | date_time_modified "2011-06-21 16:30:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1149] === UNIMOD:1149 Met→Asn |
null .Term [UNIMOD:1149] [cols="2*"] |
| id | UNIMOD:1149 | name | Met→Asn | def | "Met→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1149] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1149" | xref | delta_mono_mass "-16.997557" | xref | delta_avge_mass "-17.0934" | xref | delta_composition "H(-3) C(-1) N O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:31:14" | xref | date_time_modified "2011-06-21 16:31:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1150] === UNIMOD:1150 Met→Pro |
null .Term [UNIMOD:1150] [cols="2*"] |
| id | UNIMOD:1150 | name | Met→Pro | def | "Met→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1150] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1150" | xref | delta_mono_mass "-33.987721" | xref | delta_avge_mass "-34.0809" | xref | delta_composition "H(-2) S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:31:34" | xref | date_time_modified "2011-06-21 16:31:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1151] === UNIMOD:1151 Met→Gln |
null .Term [UNIMOD:1151] [cols="2*"] |
| id | UNIMOD:1151 | name | Met→Gln | def | "Met→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1151] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1151" | xref | delta_mono_mass "-2.981907" | xref | delta_avge_mass "-3.0668" | xref | delta_composition "H(-1) N O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:31:55" | xref | date_time_modified "2011-06-21 16:31:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1152] === UNIMOD:1152 Met→Ser |
null .Term [UNIMOD:1152] [cols="2*"] |
| id | UNIMOD:1152 | name | Met→Ser | def | "Met→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1152] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1152" | xref | delta_mono_mass "-44.008456" | xref | delta_avge_mass "-44.1188" | xref | delta_composition "H(-4) C(-2) O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:32:16" | xref | date_time_modified "2011-06-21 16:32:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1153] === UNIMOD:1153 Met→Trp |
null .Term [UNIMOD:1153] [cols="2*"] |
| id | UNIMOD:1153 | name | Met→Trp | def | "Met→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1153] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1153" | xref | delta_mono_mass "55.038828" | xref | delta_avge_mass "55.0138" | xref | delta_composition "H C(6) N S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:32:38" | xref | date_time_modified "2011-06-21 16:32:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1154] === UNIMOD:1154 Met→Tyr |
null .Term [UNIMOD:1154] [cols="2*"] |
| id | UNIMOD:1154 | name | Met→Tyr | def | "Met→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1154] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1154" | xref | delta_mono_mass "32.022844" | xref | delta_avge_mass "31.9772" | xref | delta_composition "C(4) O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:33:00" | xref | date_time_modified "2011-06-21 16:33:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1155] === UNIMOD:1155 Asn→Ala |
null .Term [UNIMOD:1155] [cols="2*"] |
| id | UNIMOD:1155 | name | Asn→Ala | def | "Asn→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1155] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1155" | xref | delta_mono_mass "-43.005814" | xref | delta_avge_mass "-43.0247" | xref | delta_composition "H(-1) C(-1) N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:36:38" | xref | date_time_modified "2011-06-21 16:36:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1156] === UNIMOD:1156 Asn→Cys |
null .Term [UNIMOD:1156] [cols="2*"] |
| id | UNIMOD:1156 | name | Asn→Cys | def | "Asn→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1156] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1156" | xref | delta_mono_mass "-11.033743" | xref | delta_avge_mass "-10.9597" | xref | delta_composition "H(-1) C(-1) N(-1) O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:37:03" | xref | date_time_modified "2011-06-21 16:37:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1157] === UNIMOD:1157 Asn→Glu |
null .Term [UNIMOD:1157] [cols="2*"] |
| id | UNIMOD:1157 | name | Asn→Glu | def | "Asn→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1157] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1157" | xref | delta_mono_mass "14.999666" | xref | delta_avge_mass "15.0113" | xref | delta_composition "H C N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:37:26" | xref | date_time_modified "2011-06-21 16:37:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1158] === UNIMOD:1158 Asn→Phe |
null .Term [UNIMOD:1158] [cols="2*"] |
| id | UNIMOD:1158 | name | Asn→Phe | def | "Asn→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1158] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1158" | xref | delta_mono_mass "33.025486" | xref | delta_avge_mass "33.0712" | xref | delta_composition "H(3) C(5) N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:37:48" | xref | date_time_modified "2011-06-21 16:37:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1159] === UNIMOD:1159 Asn→Gly |
null .Term [UNIMOD:1159] [cols="2*"] |
| id | UNIMOD:1159 | name | Asn→Gly | def | "Asn→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1159] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1159" | xref | delta_mono_mass "-57.021464" | xref | delta_avge_mass "-57.0513" | xref | delta_composition "H(-3) C(-2) N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:38:11" | xref | date_time_modified "2011-06-21 16:38:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1160] === UNIMOD:1160 Asn→Met |
null .Term [UNIMOD:1160] [cols="2*"] |
| id | UNIMOD:1160 | name | Asn→Met | def | "Asn→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1160] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1160" | xref | delta_mono_mass "16.997557" | xref | delta_avge_mass "17.0934" | xref | delta_composition "H(3) C N(-1) O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:38:32" | xref | date_time_modified "2011-06-21 16:38:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1161] === UNIMOD:1161 Asn→Pro |
null .Term [UNIMOD:1161] [cols="2*"] |
| id | UNIMOD:1161 | name | Asn→Pro | def | "Asn→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1161] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1161" | xref | delta_mono_mass "-16.990164" | xref | delta_avge_mass "-16.9875" | xref | delta_composition "H C N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:38:54" | xref | date_time_modified "2011-06-21 16:38:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1162] === UNIMOD:1162 Asn→Gln |
null .Term [UNIMOD:1162] [cols="2*"] |
| id | UNIMOD:1162 | name | Asn→Gln | def | "Asn→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1162] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1162" | xref | delta_mono_mass "14.01565" | xref | delta_avge_mass "14.0266" | xref | delta_composition "H(2) C" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:39:15" | xref | date_time_modified "2011-06-21 16:39:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1163] === UNIMOD:1163 Asn→Arg |
null .Term [UNIMOD:1163] [cols="2*"] |
| id | UNIMOD:1163 | name | Asn→Arg | def | "Asn→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1163] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1163" | xref | delta_mono_mass "42.058184" | xref | delta_avge_mass "42.083" | xref | delta_composition "H(6) C(2) N(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:39:37" | xref | date_time_modified "2011-06-21 16:39:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1164] === UNIMOD:1164 Asn→Val |
null .Term [UNIMOD:1164] [cols="2*"] |
| id | UNIMOD:1164 | name | Asn→Val | def | "Asn→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1164] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1164" | xref | delta_mono_mass "-14.974514" | xref | delta_avge_mass "-14.9716" | xref | delta_composition "H(3) C N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:39:59" | xref | date_time_modified "2011-06-21 16:39:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1165] === UNIMOD:1165 Asn→Trp |
null .Term [UNIMOD:1165] [cols="2*"] |
| id | UNIMOD:1165 | name | Asn→Trp | def | "Asn→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1165] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1165" | xref | delta_mono_mass "72.036386" | xref | delta_avge_mass "72.1073" | xref | delta_composition "H(4) C(7) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:40:21" | xref | date_time_modified "2011-06-21 16:40:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1166] === UNIMOD:1166 Pro→Cys |
null .Term [UNIMOD:1166] [cols="2*"] |
| id | UNIMOD:1166 | name | Pro→Cys | def | "Pro→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1166] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1166" | xref | delta_mono_mass "5.956421" | xref | delta_avge_mass "6.0277" | xref | delta_composition "H(-2) C(-2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 16:59:55" | xref | date_time_modified "2011-06-21 16:59:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1167] === UNIMOD:1167 Pro→Asp |
null .Term [UNIMOD:1167] [cols="2*"] |
| id | UNIMOD:1167 | name | Pro→Asp | def | "Pro→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1167] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1167" | xref | delta_mono_mass "17.974179" | xref | delta_avge_mass "17.9722" | xref | delta_composition "H(-2) C(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:00:24" | xref | date_time_modified "2011-06-21 17:00:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1168] === UNIMOD:1168 Pro→Glu |
null .Term [UNIMOD:1168] [cols="2*"] |
| id | UNIMOD:1168 | name | Pro→Glu | def | "Pro→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1168] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1168" | xref | delta_mono_mass "31.989829" | xref | delta_avge_mass "31.9988" | xref | delta_composition "O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:26:36" | xref | date_time_modified "2011-06-21 17:26:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1169] === UNIMOD:1169 Pro→Phe |
null .Term [UNIMOD:1169] [cols="2*"] |
| id | UNIMOD:1169 | name | Pro→Phe | def | "Pro→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1169] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1169" | xref | delta_mono_mass "50.01565" | xref | delta_avge_mass "50.0587" | xref | delta_composition "H(2) C(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:26:56" | xref | date_time_modified "2011-06-21 17:26:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1170] === UNIMOD:1170 Pro→Gly |
null .Term [UNIMOD:1170] [cols="2*"] |
| id | UNIMOD:1170 | name | Pro→Gly | def | "Pro→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1170] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1170" | xref | delta_mono_mass "-40.0313" | xref | delta_avge_mass "-40.0639" | xref | delta_composition "H(-4) C(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:27:17" | xref | date_time_modified "2011-06-21 17:27:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1171] === UNIMOD:1171 Pro→Lys |
null .Term [UNIMOD:1171] [cols="2*"] |
| id | UNIMOD:1171 | name | Pro→Lys | def | "Pro→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1171] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1171" | xref | delta_mono_mass "31.042199" | xref | delta_avge_mass "31.0571" | xref | delta_composition "H(5) C N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:27:38" | xref | date_time_modified "2011-06-21 17:27:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1172] === UNIMOD:1172 Pro→Met |
null .Term [UNIMOD:1172] [cols="2*"] |
| id | UNIMOD:1172 | name | Pro→Met | def | "Pro→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1172] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1172" | xref | delta_mono_mass "33.987721" | xref | delta_avge_mass "34.0809" | xref | delta_composition "H(2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:27:57" | xref | date_time_modified "2011-06-21 17:27:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1173] === UNIMOD:1173 Pro→Asn |
null .Term [UNIMOD:1173] [cols="2*"] |
| id | UNIMOD:1173 | name | Pro→Asn | def | "Pro→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1173] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1173" | xref | delta_mono_mass "16.990164" | xref | delta_avge_mass "16.9875" | xref | delta_composition "H(-1) C(-1) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:28:18" | xref | date_time_modified "2011-06-21 17:28:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1174] === UNIMOD:1174 Pro→Val |
null .Term [UNIMOD:1174] [cols="2*"] |
| id | UNIMOD:1174 | name | Pro→Val | def | "Pro→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1174] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1174" | xref | delta_mono_mass "2.01565" | xref | delta_avge_mass "2.0159" | xref | delta_composition "H(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:28:41" | xref | date_time_modified "2011-06-21 17:28:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1175] === UNIMOD:1175 Pro→Trp |
null .Term [UNIMOD:1175] [cols="2*"] |
| id | UNIMOD:1175 | name | Pro→Trp | def | "Pro→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1175] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1175" | xref | delta_mono_mass "89.026549" | xref | delta_avge_mass "89.0947" | xref | delta_composition "H(3) C(6) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:29:04" | xref | date_time_modified "2011-06-21 17:29:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1176] === UNIMOD:1176 Pro→Tyr |
null .Term [UNIMOD:1176] [cols="2*"] |
| id | UNIMOD:1176 | name | Pro→Tyr | def | "Pro→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1176] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1176" | xref | delta_mono_mass "66.010565" | xref | delta_avge_mass "66.0581" | xref | delta_composition "H(2) C(4) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:29:24" | xref | date_time_modified "2011-06-21 17:29:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1177] === UNIMOD:1177 Gln→Ala |
null .Term [UNIMOD:1177] [cols="2*"] |
| id | UNIMOD:1177 | name | Gln→Ala | def | "Gln→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1177] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1177" | xref | delta_mono_mass "-57.021464" | xref | delta_avge_mass "-57.0513" | xref | delta_composition "H(-3) C(-2) N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:39:52" | xref | date_time_modified "2011-06-21 17:39:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1178] === UNIMOD:1178 Gln→Cys |
null .Term [UNIMOD:1178] [cols="2*"] |
| id | UNIMOD:1178 | name | Gln→Cys | def | "Gln→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1178] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1178" | xref | delta_mono_mass "-25.049393" | xref | delta_avge_mass "-24.9863" | xref | delta_composition "H(-3) C(-2) N(-1) O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:40:20" | xref | date_time_modified "2011-06-21 17:40:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1179] === UNIMOD:1179 Gln→Asp |
null .Term [UNIMOD:1179] [cols="2*"] |
| id | UNIMOD:1179 | name | Gln→Asp | def | "Gln→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1179] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1179" | xref | delta_mono_mass "-13.031634" | xref | delta_avge_mass "-13.0418" | xref | delta_composition "H(-3) C(-1) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:40:42" | xref | date_time_modified "2011-06-21 17:40:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1180] === UNIMOD:1180 Gln→Phe |
null .Term [UNIMOD:1180] [cols="2*"] |
| id | UNIMOD:1180 | name | Gln→Phe | def | "Gln→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1180] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1180" | xref | delta_mono_mass "19.009836" | xref | delta_avge_mass "19.0446" | xref | delta_composition "H C(4) N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:41:04" | xref | date_time_modified "2011-06-21 17:41:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1181] === UNIMOD:1181 Gln→Gly |
null .Term [UNIMOD:1181] [cols="2*"] |
| id | UNIMOD:1181 | name | Gln→Gly | def | "Gln→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1181] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1181" | xref | delta_mono_mass "-71.037114" | xref | delta_avge_mass "-71.0779" | xref | delta_composition "H(-5) C(-3) N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:41:24" | xref | date_time_modified "2011-06-21 17:41:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1182] === UNIMOD:1182 Gln→Met |
null .Term [UNIMOD:1182] [cols="2*"] |
| id | UNIMOD:1182 | name | Gln→Met | def | "Gln→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1182] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1182" | xref | delta_mono_mass "2.981907" | xref | delta_avge_mass "3.0668" | xref | delta_composition "H N(-1) O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:41:53" | xref | date_time_modified "2011-06-21 17:41:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1183] === UNIMOD:1183 Gln→Asn |
null .Term [UNIMOD:1183] [cols="2*"] |
| id | UNIMOD:1183 | name | Gln→Asn | def | "Gln→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1183] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1183" | xref | delta_mono_mass "-14.01565" | xref | delta_avge_mass "-14.0266" | xref | delta_composition "H(-2) C(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:42:17" | xref | date_time_modified "2011-06-21 17:42:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1184] === UNIMOD:1184 Gln→Ser |
null .Term [UNIMOD:1184] [cols="2*"] |
| id | UNIMOD:1184 | name | Gln→Ser | def | "Gln→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1184] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1184" | xref | delta_mono_mass "-41.026549" | xref | delta_avge_mass "-41.0519" | xref | delta_composition "H(-3) C(-2) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:42:37" | xref | date_time_modified "2011-06-21 17:42:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1185] === UNIMOD:1185 Gln→Thr |
null .Term [UNIMOD:1185] [cols="2*"] |
| id | UNIMOD:1185 | name | Gln→Thr | def | "Gln→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1185] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1185" | xref | delta_mono_mass "-27.010899" | xref | delta_avge_mass "-27.0253" | xref | delta_composition "H(-1) C(-1) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:42:58" | xref | date_time_modified "2011-06-21 17:42:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1186] === UNIMOD:1186 Gln→Val |
null .Term [UNIMOD:1186] [cols="2*"] |
| id | UNIMOD:1186 | name | Gln→Val | def | "Gln→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1186] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1186" | xref | delta_mono_mass "-28.990164" | xref | delta_avge_mass "-28.9982" | xref | delta_composition "H N(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:43:20" | xref | date_time_modified "2011-06-21 17:43:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1187] === UNIMOD:1187 Gln→Trp |
null .Term [UNIMOD:1187] [cols="2*"] |
| id | UNIMOD:1187 | name | Gln→Trp | def | "Gln→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1187] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1187" | xref | delta_mono_mass "58.020735" | xref | delta_avge_mass "58.0807" | xref | delta_composition "H(2) C(6) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:43:42" | xref | date_time_modified "2011-06-21 17:43:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1188] === UNIMOD:1188 Gln→Tyr |
null .Term [UNIMOD:1188] [cols="2*"] |
| id | UNIMOD:1188 | name | Gln→Tyr | def | "Gln→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1188] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1188" | xref | delta_mono_mass "35.004751" | xref | delta_avge_mass "35.044" | xref | delta_composition "H C(4) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-21 17:44:02" | xref | date_time_modified "2011-06-21 17:44:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1189] === UNIMOD:1189 Arg→Ala |
null .Term [UNIMOD:1189] [cols="2*"] |
| id | UNIMOD:1189 | name | Arg→Ala | def | "Arg→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1189] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1189" | xref | delta_mono_mass "-85.063997" | xref | delta_avge_mass "-85.1078" | xref | delta_composition "H(-7) C(-3) N(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:47:36" | xref | date_time_modified "2011-06-23 10:47:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1190] === UNIMOD:1190 Arg→Asp |
null .Term [UNIMOD:1190] [cols="2*"] |
| id | UNIMOD:1190 | name | Arg→Asp | def | "Arg→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1190] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1190" | xref | delta_mono_mass "-41.074168" | xref | delta_avge_mass "-41.0983" | xref | delta_composition "H(-7) C(-2) N(-3) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:48:03" | xref | date_time_modified "2011-06-23 10:48:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1191] === UNIMOD:1191 Arg→Glu |
null .Term [UNIMOD:1191] [cols="2*"] |
| id | UNIMOD:1191 | name | Arg→Glu | def | "Arg→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1191] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1191" | xref | delta_mono_mass "-27.058518" | xref | delta_avge_mass "-27.0717" | xref | delta_composition "H(-5) C(-1) N(-3) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:48:51" | xref | date_time_modified "2011-06-23 10:48:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1192] === UNIMOD:1192 Arg→Asn |
null .Term [UNIMOD:1192] [cols="2*"] |
| id | UNIMOD:1192 | name | Arg→Asn | def | "Arg→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1192] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1192" | xref | delta_mono_mass "-42.058184" | xref | delta_avge_mass "-42.083" | xref | delta_composition "H(-6) C(-2) N(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:49:09" | xref | date_time_modified "2011-06-23 10:49:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1193] === UNIMOD:1193 Arg→Val |
null .Term [UNIMOD:1193] [cols="2*"] |
| id | UNIMOD:1193 | name | Arg→Val | def | "Arg→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1193] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1193" | xref | delta_mono_mass "-57.032697" | xref | delta_avge_mass "-57.0546" | xref | delta_composition "H(-3) C(-1) N(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:49:53" | xref | date_time_modified "2011-06-23 10:49:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1194] === UNIMOD:1194 Arg→Tyr |
null .Term [UNIMOD:1194] [cols="2*"] |
| id | UNIMOD:1194 | name | Arg→Tyr | def | "Arg→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1194] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1194" | xref | delta_mono_mass "6.962218" | xref | delta_avge_mass "6.9876" | xref | delta_composition "H(-3) C(3) N(-3) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:50:15" | xref | date_time_modified "2011-06-23 10:50:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1195] === UNIMOD:1195 Arg→Phe |
null .Term [UNIMOD:1195] [cols="2*"] |
| id | UNIMOD:1195 | name | Arg→Phe | def | "Arg→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1195] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1195" | xref | delta_mono_mass "-9.032697" | xref | delta_avge_mass "-9.0118" | xref | delta_composition "H(-3) C(3) N(-3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:55:03" | xref | date_time_modified "2011-06-23 10:55:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1196] === UNIMOD:1196 Ser→Asp |
null .Term [UNIMOD:1196] [cols="2*"] |
| id | UNIMOD:1196 | name | Ser→Asp | def | "Ser→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1196] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1196" | xref | delta_mono_mass "27.994915" | xref | delta_avge_mass "28.0101" | xref | delta_composition "C O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:57:45" | xref | date_time_modified "2011-06-23 10:57:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1197] === UNIMOD:1197 Ser→Glu |
null .Term [UNIMOD:1197] [cols="2*"] |
| id | UNIMOD:1197 | name | Ser→Glu | def | "Ser→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1197] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1197" | xref | delta_mono_mass "42.010565" | xref | delta_avge_mass "42.0367" | xref | delta_composition "H(2) C(2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:58:11" | xref | date_time_modified "2011-06-23 10:58:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1198] === UNIMOD:1198 Ser→His |
null .Term [UNIMOD:1198] [cols="2*"] |
| id | UNIMOD:1198 | name | Ser→His | def | "Ser→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1198] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1198" | xref | delta_mono_mass "50.026883" | xref | delta_avge_mass "50.062" | xref | delta_composition "H(2) C(3) N(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:58:34" | xref | date_time_modified "2011-06-23 10:58:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1199] === UNIMOD:1199 Ser→Lys |
null .Term [UNIMOD:1199] [cols="2*"] |
| id | UNIMOD:1199 | name | Ser→Lys | def | "Ser→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1199] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1199" | xref | delta_mono_mass "41.062935" | xref | delta_avge_mass "41.095" | xref | delta_composition "H(7) C(3) N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:58:58" | xref | date_time_modified "2011-06-23 10:58:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1200] === UNIMOD:1200 Ser→Met |
null .Term [UNIMOD:1200] [cols="2*"] |
| id | UNIMOD:1200 | name | Ser→Met | def | "Ser→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1200] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1200" | xref | delta_mono_mass "44.008456" | xref | delta_avge_mass "44.1188" | xref | delta_composition "H(4) C(2) O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:59:19" | xref | date_time_modified "2011-06-23 10:59:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1201] === UNIMOD:1201 Ser→Gln |
null .Term [UNIMOD:1201] [cols="2*"] |
| id | UNIMOD:1201 | name | Ser→Gln | def | "Ser→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1201] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1201" | xref | delta_mono_mass "41.026549" | xref | delta_avge_mass "41.0519" | xref | delta_composition "H(3) C(2) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:59:38" | xref | date_time_modified "2011-06-23 10:59:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1202] === UNIMOD:1202 Ser→Val |
null .Term [UNIMOD:1202] [cols="2*"] |
| id | UNIMOD:1202 | name | Ser→Val | def | "Ser→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1202] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1202" | xref | delta_mono_mass "12.036386" | xref | delta_avge_mass "12.0538" | xref | delta_composition "H(4) C(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 10:59:59" | xref | date_time_modified "2011-06-23 10:59:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1203] === UNIMOD:1203 Thr→Cys |
null .Term [UNIMOD:1203] [cols="2*"] |
| id | UNIMOD:1203 | name | Thr→Cys | def | "Thr→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1203] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1203" | xref | delta_mono_mass "1.961506" | xref | delta_avge_mass "2.039" | xref | delta_composition "H(-2) C(-1) O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:00:56" | xref | date_time_modified "2011-06-23 11:00:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1204] === UNIMOD:1204 Thr→Asp |
null .Term [UNIMOD:1204] [cols="2*"] |
| id | UNIMOD:1204 | name | Thr→Asp | def | "Thr→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1204] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1204" | xref | delta_mono_mass "13.979265" | xref | delta_avge_mass "13.9835" | xref | delta_composition "H(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:01:35" | xref | date_time_modified "2011-06-23 11:01:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1205] === UNIMOD:1205 Thr→Glu |
null .Term [UNIMOD:1205] [cols="2*"] |
| id | UNIMOD:1205 | name | Thr→Glu | def | "Thr→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1205] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1205" | xref | delta_mono_mass "27.994915" | xref | delta_avge_mass "28.0101" | xref | delta_composition "C O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:02:00" | xref | date_time_modified "2011-06-23 11:02:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1206] === UNIMOD:1206 Thr→Phe |
null .Term [UNIMOD:1206] [cols="2*"] |
| id | UNIMOD:1206 | name | Thr→Phe | def | "Thr→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1206] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1206" | xref | delta_mono_mass "46.020735" | xref | delta_avge_mass "46.07" | xref | delta_composition "H(2) C(5) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:02:21" | xref | date_time_modified "2011-06-23 11:02:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1207] === UNIMOD:1207 Thr→Gly |
null .Term [UNIMOD:1207] [cols="2*"] |
| id | UNIMOD:1207 | name | Thr→Gly | def | "Thr→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1207] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1207" | xref | delta_mono_mass "-44.026215" | xref | delta_avge_mass "-44.0526" | xref | delta_composition "H(-4) C(-2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:02:41" | xref | date_time_modified "2011-06-23 11:02:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1208] === UNIMOD:1208 Thr→His |
null .Term [UNIMOD:1208] [cols="2*"] |
| id | UNIMOD:1208 | name | Thr→His | def | "Thr→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1208] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1208" | xref | delta_mono_mass "36.011233" | xref | delta_avge_mass "36.0354" | xref | delta_composition "C(2) N(2) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:03:03" | xref | date_time_modified "2011-06-23 11:03:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1209] === UNIMOD:1209 Thr→Gln |
null .Term [UNIMOD:1209] [cols="2*"] |
| id | UNIMOD:1209 | name | Thr→Gln | def | "Thr→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1209] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1209" | xref | delta_mono_mass "27.010899" | xref | delta_avge_mass "27.0253" | xref | delta_composition "H C N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:03:26" | xref | date_time_modified "2011-06-23 11:03:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1210] === UNIMOD:1210 Thr→Val |
null .Term [UNIMOD:1210] [cols="2*"] |
| id | UNIMOD:1210 | name | Thr→Val | def | "Thr→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1210] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1210" | xref | delta_mono_mass "-1.979265" | xref | delta_avge_mass "-1.9728" | xref | delta_composition "H(2) C O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:03:48" | xref | date_time_modified "2011-06-23 11:03:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1211] === UNIMOD:1211 Thr→Trp |
null .Term [UNIMOD:1211] [cols="2*"] |
| id | UNIMOD:1211 | name | Thr→Trp | def | "Thr→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1211] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1211" | xref | delta_mono_mass "85.031634" | xref | delta_avge_mass "85.106" | xref | delta_composition "H(3) C(7) N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:04:08" | xref | date_time_modified "2011-06-23 11:04:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1212] === UNIMOD:1212 Thr→Tyr |
null .Term [UNIMOD:1212] [cols="2*"] |
| id | UNIMOD:1212 | name | Thr→Tyr | def | "Thr→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1212] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1212" | xref | delta_mono_mass "62.01565" | xref | delta_avge_mass "62.0694" | xref | delta_composition "H(2) C(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:04:28" | xref | date_time_modified "2011-06-23 11:04:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1213] === UNIMOD:1213 Val→Cys |
null .Term [UNIMOD:1213] [cols="2*"] |
| id | UNIMOD:1213 | name | Val→Cys | def | "Val→Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1213] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1213" | xref | delta_mono_mass "3.940771" | xref | delta_avge_mass "4.0118" | xref | delta_composition "H(-4) C(-2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:19:57" | xref | date_time_modified "2011-06-23 11:19:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1214] === UNIMOD:1214 Val→His |
null .Term [UNIMOD:1214] [cols="2*"] |
| id | UNIMOD:1214 | name | Val→His | def | "Val→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1214] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1214" | xref | delta_mono_mass "37.990498" | xref | delta_avge_mass "38.0082" | xref | delta_composition "H(-2) C N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:20:23" | xref | date_time_modified "2011-06-23 11:20:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1215] === UNIMOD:1215 Val→Lys |
null .Term [UNIMOD:1215] [cols="2*"] |
| id | UNIMOD:1215 | name | Val→Lys | def | "Val→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1215] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1215" | xref | delta_mono_mass "29.026549" | xref | delta_avge_mass "29.0412" | xref | delta_composition "H(3) C N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:20:45" | xref | date_time_modified "2011-06-23 11:20:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1216] === UNIMOD:1216 Val→Asn |
null .Term [UNIMOD:1216] [cols="2*"] |
| id | UNIMOD:1216 | name | Val→Asn | def | "Val→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1216] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1216" | xref | delta_mono_mass "14.974514" | xref | delta_avge_mass "14.9716" | xref | delta_composition "H(-3) C(-1) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:21:04" | xref | date_time_modified "2011-06-23 11:21:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1217] === UNIMOD:1217 Val→Pro |
null .Term [UNIMOD:1217] [cols="2*"] |
| id | UNIMOD:1217 | name | Val→Pro | def | "Val→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1217] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1217" | xref | delta_mono_mass "-2.01565" | xref | delta_avge_mass "-2.0159" | xref | delta_composition "H(-2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:21:23" | xref | date_time_modified "2011-06-23 11:21:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1218] === UNIMOD:1218 Val→Gln |
null .Term [UNIMOD:1218] [cols="2*"] |
| id | UNIMOD:1218 | name | Val→Gln | def | "Val→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1218] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1218" | xref | delta_mono_mass "28.990164" | xref | delta_avge_mass "28.9982" | xref | delta_composition "H(-1) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:21:42" | xref | date_time_modified "2011-06-23 11:21:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1219] === UNIMOD:1219 Val→Arg |
null .Term [UNIMOD:1219] [cols="2*"] |
| id | UNIMOD:1219 | name | Val→Arg | def | "Val→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1219] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1219" | xref | delta_mono_mass "57.032697" | xref | delta_avge_mass "57.0546" | xref | delta_composition "H(3) C N(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:22:05" | xref | date_time_modified "2011-06-23 11:22:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1220] === UNIMOD:1220 Val→Ser |
null .Term [UNIMOD:1220] [cols="2*"] |
| id | UNIMOD:1220 | name | Val→Ser | def | "Val→Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1220] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1220" | xref | delta_mono_mass "-12.036386" | xref | delta_avge_mass "-12.0538" | xref | delta_composition "H(-4) C(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:22:26" | xref | date_time_modified "2011-06-23 11:22:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1221] === UNIMOD:1221 Val→Thr |
null .Term [UNIMOD:1221] [cols="2*"] |
| id | UNIMOD:1221 | name | Val→Thr | def | "Val→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1221] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1221" | xref | delta_mono_mass "1.979265" | xref | delta_avge_mass "1.9728" | xref | delta_composition "H(-2) C(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:22:49" | xref | date_time_modified "2011-06-23 11:22:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1222] === UNIMOD:1222 Val→Trp |
null .Term [UNIMOD:1222] [cols="2*"] |
| id | UNIMOD:1222 | name | Val→Trp | def | "Val→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1222] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1222" | xref | delta_mono_mass "87.010899" | xref | delta_avge_mass "87.0788" | xref | delta_composition "H C(6) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:23:11" | xref | date_time_modified "2011-06-23 11:23:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1223] === UNIMOD:1223 Val→Tyr |
null .Term [UNIMOD:1223] [cols="2*"] |
| id | UNIMOD:1223 | name | Val→Tyr | def | "Val→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1223] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1223" | xref | delta_mono_mass "63.994915" | xref | delta_avge_mass "64.0422" | xref | delta_composition "C(4) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:23:33" | xref | date_time_modified "2011-06-23 11:23:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "V" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1224] === UNIMOD:1224 Trp→Ala |
null .Term [UNIMOD:1224] [cols="2*"] |
| id | UNIMOD:1224 | name | Trp→Ala | def | "Trp→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1224] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1224" | xref | delta_mono_mass "-115.042199" | xref | delta_avge_mass "-115.132" | xref | delta_composition "H(-5) C(-8) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:39:07" | xref | date_time_modified "2011-06-23 11:39:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1225] === UNIMOD:1225 Trp→Asp |
null .Term [UNIMOD:1225] [cols="2*"] |
| id | UNIMOD:1225 | name | Trp→Asp | def | "Trp→Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1225] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1225" | xref | delta_mono_mass "-71.05237" | xref | delta_avge_mass "-71.1225" | xref | delta_composition "H(-5) C(-7) N(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:40:26" | xref | date_time_modified "2011-06-23 11:40:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1226] === UNIMOD:1226 Trp→Glu |
null .Term [UNIMOD:1226] [cols="2*"] |
| id | UNIMOD:1226 | name | Trp→Glu | def | "Trp→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1226] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1226" | xref | delta_mono_mass "-57.03672" | xref | delta_avge_mass "-57.0959" | xref | delta_composition "H(-3) C(-6) N(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:40:48" | xref | date_time_modified "2011-06-23 11:40:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1227] === UNIMOD:1227 Trp→Phe |
null .Term [UNIMOD:1227] [cols="2*"] |
| id | UNIMOD:1227 | name | Trp→Phe | def | "Trp→Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1227] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1227" | xref | delta_mono_mass "-39.010899" | xref | delta_avge_mass "-39.036" | xref | delta_composition "H(-1) C(-2) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:41:09" | xref | date_time_modified "2011-06-23 11:41:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1228] === UNIMOD:1228 Trp→His |
null .Term [UNIMOD:1228] [cols="2*"] |
| id | UNIMOD:1228 | name | Trp→His | def | "Trp→His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1228] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1228" | xref | delta_mono_mass "-49.020401" | xref | delta_avge_mass "-49.0706" | xref | delta_composition "H(-3) C(-5) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:41:32" | xref | date_time_modified "2011-06-23 11:41:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1229] === UNIMOD:1229 Trp→Lys |
null .Term [UNIMOD:1229] [cols="2*"] |
| id | UNIMOD:1229 | name | Trp→Lys | def | "Trp→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1229] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1229" | xref | delta_mono_mass "-57.98435" | xref | delta_avge_mass "-58.0376" | xref | delta_composition "H(2) C(-5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:41:52" | xref | date_time_modified "2011-06-23 11:41:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1230] === UNIMOD:1230 Trp→Met |
null .Term [UNIMOD:1230] [cols="2*"] |
| id | UNIMOD:1230 | name | Trp→Met | def | "Trp→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1230] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1230" | xref | delta_mono_mass "-55.038828" | xref | delta_avge_mass "-55.0138" | xref | delta_composition "H(-1) C(-6) N(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:42:11" | xref | date_time_modified "2011-06-23 11:42:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1231] === UNIMOD:1231 Trp→Asn |
null .Term [UNIMOD:1231] [cols="2*"] |
| id | UNIMOD:1231 | name | Trp→Asn | def | "Trp→Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1231] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1231" | xref | delta_mono_mass "-72.036386" | xref | delta_avge_mass "-72.1073" | xref | delta_composition "H(-4) C(-7) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:42:32" | xref | date_time_modified "2011-06-23 11:42:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1232] === UNIMOD:1232 Trp→Pro |
null .Term [UNIMOD:1232] [cols="2*"] |
| id | UNIMOD:1232 | name | Trp→Pro | def | "Trp→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1232] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1232" | xref | delta_mono_mass "-89.026549" | xref | delta_avge_mass "-89.0947" | xref | delta_composition "H(-3) C(-6) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:42:53" | xref | date_time_modified "2011-06-23 11:42:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1233] === UNIMOD:1233 Trp→Gln |
null .Term [UNIMOD:1233] [cols="2*"] |
| id | UNIMOD:1233 | name | Trp→Gln | def | "Trp→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1233] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1233" | xref | delta_mono_mass "-58.020735" | xref | delta_avge_mass "-58.0807" | xref | delta_composition "H(-2) C(-6) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:43:14" | xref | date_time_modified "2011-06-23 11:43:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1234] === UNIMOD:1234 Trp→Thr |
null .Term [UNIMOD:1234] [cols="2*"] |
| id | UNIMOD:1234 | name | Trp→Thr | def | "Trp→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1234] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1234" | xref | delta_mono_mass "-85.031634" | xref | delta_avge_mass "-85.106" | xref | delta_composition "H(-3) C(-7) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:43:34" | xref | date_time_modified "2011-06-23 11:43:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1235] === UNIMOD:1235 Trp→Val |
null .Term [UNIMOD:1235] [cols="2*"] |
| id | UNIMOD:1235 | name | Trp→Val | def | "Trp→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1235] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1235" | xref | delta_mono_mass "-87.010899" | xref | delta_avge_mass "-87.0788" | xref | delta_composition "H(-1) C(-6) N(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:43:54" | xref | date_time_modified "2011-06-23 11:43:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1236] === UNIMOD:1236 Trp→Tyr |
null .Term [UNIMOD:1236] [cols="2*"] |
| id | UNIMOD:1236 | name | Trp→Tyr | def | "Trp→Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1236] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1236" | xref | delta_mono_mass "-23.015984" | xref | delta_avge_mass "-23.0366" | xref | delta_composition "H(-1) C(-2) N(-1) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:44:18" | xref | date_time_modified "2011-06-23 11:44:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1237] === UNIMOD:1237 Tyr→Ala |
null .Term [UNIMOD:1237] [cols="2*"] |
| id | UNIMOD:1237 | name | Tyr→Ala | def | "Tyr→Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1237] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1237" | xref | delta_mono_mass "-92.026215" | xref | delta_avge_mass "-92.0954" | xref | delta_composition "H(-4) C(-6) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:46:23" | xref | date_time_modified "2011-06-23 11:46:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1238] === UNIMOD:1238 Tyr→Glu |
null .Term [UNIMOD:1238] [cols="2*"] |
| id | UNIMOD:1238 | name | Tyr→Glu | def | "Tyr→Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1238] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1238" | xref | delta_mono_mass "-34.020735" | xref | delta_avge_mass "-34.0593" | xref | delta_composition "H(-2) C(-4) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:46:45" | xref | date_time_modified "2011-06-23 11:46:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1239] === UNIMOD:1239 Tyr→Gly |
null .Term [UNIMOD:1239] [cols="2*"] |
| id | UNIMOD:1239 | name | Tyr→Gly | def | "Tyr→Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1239] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1239" | xref | delta_mono_mass "-106.041865" | xref | delta_avge_mass "-106.1219" | xref | delta_composition "H(-6) C(-7) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:47:05" | xref | date_time_modified "2011-06-23 11:47:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1240] === UNIMOD:1240 Tyr→Lys |
null .Term [UNIMOD:1240] [cols="2*"] |
| id | UNIMOD:1240 | name | Tyr→Lys | def | "Tyr→Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1240] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1240" | xref | delta_mono_mass "-34.968366" | xref | delta_avge_mass "-35.001" | xref | delta_composition "H(3) C(-3) N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:47:23" | xref | date_time_modified "2011-06-23 11:47:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1241] === UNIMOD:1241 Tyr→Met |
null .Term [UNIMOD:1241] [cols="2*"] |
| id | UNIMOD:1241 | name | Tyr→Met | def | "Tyr→Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1241] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1241" | xref | delta_mono_mass "-32.022844" | xref | delta_avge_mass "-31.9772" | xref | delta_composition "C(-4) O(-1) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:47:43" | xref | date_time_modified "2011-06-23 11:47:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1242] === UNIMOD:1242 Tyr→Pro |
null .Term [UNIMOD:1242] [cols="2*"] |
| id | UNIMOD:1242 | name | Tyr→Pro | def | "Tyr→Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1242] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1242" | xref | delta_mono_mass "-66.010565" | xref | delta_avge_mass "-66.0581" | xref | delta_composition "H(-2) C(-4) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:48:07" | xref | date_time_modified "2011-06-23 11:48:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1243] === UNIMOD:1243 Tyr→Gln |
null .Term [UNIMOD:1243] [cols="2*"] |
| id | UNIMOD:1243 | name | Tyr→Gln | def | "Tyr→Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1243] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1243" | xref | delta_mono_mass "-35.004751" | xref | delta_avge_mass "-35.044" | xref | delta_composition "H(-1) C(-4) N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:48:28" | xref | date_time_modified "2011-06-23 11:48:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1244] === UNIMOD:1244 Tyr→Arg |
null .Term [UNIMOD:1244] [cols="2*"] |
| id | UNIMOD:1244 | name | Tyr→Arg | def | "Tyr→Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1244] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1244" | xref | delta_mono_mass "-6.962218" | xref | delta_avge_mass "-6.9876" | xref | delta_composition "H(3) C(-3) N(3) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:48:49" | xref | date_time_modified "2011-06-23 11:48:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1245] === UNIMOD:1245 Tyr→Thr |
null .Term [UNIMOD:1245] [cols="2*"] |
| id | UNIMOD:1245 | name | Tyr→Thr | def | "Tyr→Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1245] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1245" | xref | delta_mono_mass "-62.01565" | xref | delta_avge_mass "-62.0694" | xref | delta_composition "H(-2) C(-5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:49:10" | xref | date_time_modified "2011-06-23 11:49:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1246] === UNIMOD:1246 Tyr→Val |
null .Term [UNIMOD:1246] [cols="2*"] |
| id | UNIMOD:1246 | name | Tyr→Val | def | "Tyr→Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1246] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1246" | xref | delta_mono_mass "-63.994915" | xref | delta_avge_mass "-64.0422" | xref | delta_composition "C(-4) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:49:30" | xref | date_time_modified "2011-06-23 11:49:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1247] === UNIMOD:1247 Tyr→Trp |
null .Term [UNIMOD:1247] [cols="2*"] |
| id | UNIMOD:1247 | name | Tyr→Trp | def | "Tyr→Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1247] | synonym | "Misacylation of the tRNA or editing of the charged tRNA" [] | xref | record_id "1247" | xref | delta_mono_mass "23.015984" | xref | delta_avge_mass "23.0366" | xref | delta_composition "H C(2) N O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:49:50" | xref | date_time_modified "2011-06-23 11:49:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1248] === UNIMOD:1248 Tyr→Xle |
null .Term [UNIMOD:1248] [cols="2*"] |
| id | UNIMOD:1248 | name | Tyr→Xle | def | "Tyr→Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1248] | xref | record_id "1248" | xref | delta_mono_mass "-49.979265" | xref | delta_avge_mass "-50.0156" | xref | delta_composition "H(2) C(-3) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-06-23 11:53:26" | xref | date_time_modified "2011-06-23 11:53:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "AA substitution" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1249] === UNIMOD:1249 AHA-SS |
null .Term [UNIMOD:1249] [cols="2*"] |
| id | UNIMOD:1249 | name | AHA-SS | def | "Azidohomoalanine coupled to reductively cleaved tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1249] | xref | record_id "1249" | xref | delta_mono_mass "195.075625" | xref | delta_avge_mass "195.1787" | xref | delta_composition "H(9) C(7) N(5) O(2)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-06-24 10:58:26" | xref | date_time_modified "2011-06-27 17:38:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1250] === UNIMOD:1250 AHA-SS_CAM |
null .Term [UNIMOD:1250] [cols="2*"] |
| id | UNIMOD:1250 | name | AHA-SS_CAM | def | "Carbamidomethylated form of reductively cleaved tag coupled to azidohomoalanine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1250] | xref | record_id "1250" | xref | delta_mono_mass "252.097088" | xref | delta_avge_mass "252.23" | xref | delta_composition "H(12) C(9) N(6) O(3)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-06-24 11:00:11" | xref | date_time_modified "2011-06-27 17:39:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Multiple" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1251] === UNIMOD:1251 Biotin:Thermo-33033 |
null .Term [UNIMOD:1251] [cols="2*"] |
| id | UNIMOD:1251 | name | Biotin:Thermo-33033 | def | "Sulfo-SBED Label Photoreactive Biotin Crosslinker." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1251] | xref | record_id "1251" | xref | delta_mono_mass "548.223945" | xref | delta_avge_mass "548.7211" | xref | delta_composition "H(36) C(25) N(6) O(4) S(2)" | xref | username_of_poster "Magnojunqueira" | xref | group_of_poster "" | xref | date_time_posted "2011-06-24 16:58:05" | xref | date_time_modified "2013-04-16 23:21:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "Sulfo-SBED Label Transfer ReagentrnReaction path that does not remove one Hidrogen atom from the target peptide" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1252] === UNIMOD:1252 Biotin:Thermo-33033-H |
null .Term [UNIMOD:1252] [cols="2*"] |
| id | UNIMOD:1252 | name | Biotin:Thermo-33033-H | def | "Sulfo-SBED Label Photoreactive Biotin Crosslinker minus Hydrogen." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1252] | xref | record_id "1252" | xref | delta_mono_mass "546.208295" | xref | delta_avge_mass "546.7053" | xref | delta_composition "H(34) C(25) N(6) O(4) S(2)" | xref | username_of_poster "Magnojunqueira" | xref | group_of_poster "" | xref | date_time_posted "2011-06-24 17:01:13" | xref | date_time_modified "2011-06-24 21:16:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "Sulfo-SBED Label Transfer Reagent. Reaction path that removes one Hydrogen atom from the target peptide" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1253] === UNIMOD:1253 2-monomethylsuccinyl |
null .Term [UNIMOD:1253] [cols="2*"] |
| id | UNIMOD:1253 | name | 2-monomethylsuccinyl | def | "S-(2-monomethylsuccinyl) cysteine." [URL:http\://www.chemblink.com/products/2756-87-8.htm, PMID:http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=5369209, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1253] | xref | record_id "1253" | xref | delta_mono_mass "130.026609" | xref | delta_avge_mass "130.0987" | xref | delta_composition "H(6) C(5) O(4)" | xref | username_of_poster "JMcGouran" | xref | group_of_poster "" | xref | date_time_posted "2011-06-28 15:27:43" | xref | date_time_modified "2011-07-12 14:25:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1254] === UNIMOD:1254 Saligenin |
null .Term [UNIMOD:1254] [cols="2*"] |
| id | UNIMOD:1254 | name | Saligenin | def | "O-toluene." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1254] | comment | Believed to be created in a secondary reaction after initial formation of an adduct between the organophosphate 2-(o-cresyl)-4H-1,3,2-benzodioxaphosphorane-2-one and Tyr or Ser in proteins. | xref | record_id "1254" | xref | delta_mono_mass "106.041865" | xref | delta_avge_mass "106.1219" | xref | delta_composition "H(6) C(7) O" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2011-06-30 19:24:11" | xref | date_time_modified "2011-07-09 09:17:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1255] === UNIMOD:1255 Cresylphosphate |
null .Term [UNIMOD:1255] [cols="2*"] |
| id | UNIMOD:1255 | name | Cresylphosphate | def | "O-toluyl-phosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1255] | comment | Created by hydrolysis of the product of the reaction of 2-(o-cresyl)-4H-1,3,2-benzodioxaphosphorane-2-one with amino acids residues in proteins. | xref | record_id "1255" | xref | delta_mono_mass "170.013281" | xref | delta_avge_mass "170.1024" | xref | delta_composition "H(7) C(7) O(3) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2011-06-30 19:33:14" | xref | date_time_modified "2011-07-09 09:20:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "R" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1256] === UNIMOD:1256 CresylSaligeninPhosphate |
null .Term [UNIMOD:1256] [cols="2*"] |
| id | UNIMOD:1256 | name | CresylSaligeninPhosphate | def | "Cresyl-Saligenin-phosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1256] | comment | Created by reaction of 2-(o-cresyl)-4H-1,3,2-benzodioxaphosphorane-2-one with amino acid residues in proteins. | xref | record_id "1256" | xref | delta_mono_mass "276.055146" | xref | delta_avge_mass "276.2244" | xref | delta_composition "H(13) C(14) O(4) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2011-06-30 19:38:15" | xref | date_time_modified "2011-07-09 09:21:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "R" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1257] === UNIMOD:1257 Ub-Br2 |
null .Term [UNIMOD:1257] [cols="2*"] |
| id | UNIMOD:1257 | name | Ub-Br2 | def | "Ub Bromide probe addition." [URL:http\://www.enzolifesciences.com/fileadmin/reports/els_0a605e18ec.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1257] | synonym | "Active site DUB cystine modification with Br Ub probe Trypsin Digestion reminant of Ub Br probe" [] | xref | record_id "1257" | xref | delta_mono_mass "100.063663" | xref | delta_avge_mass "100.1191" | xref | delta_composition "H(8) C(4) N(2) O" | xref | username_of_poster "JMcGouran" | xref | group_of_poster "" | xref | date_time_posted "2011-07-01 13:25:05" | xref | date_time_modified "2011-07-11 11:30:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1258] === UNIMOD:1258 Ub-VME |
null .Term [UNIMOD:1258] [cols="2*"] |
| id | UNIMOD:1258 | name | Ub-VME | def | "Ubiquitin vinylmethylester." [URL:http\://www.lifesensors.com/pdf/Ub-VME_datasheet.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1258] | synonym | "Active site DUB cystine modification with VME Ub probe Trypsin Digestion reminant of Ub VMEr probe" [] | xref | record_id "1258" | xref | delta_mono_mass "173.092617" | xref | delta_avge_mass "173.1897" | xref | delta_composition "H(13) C(7) N(2) O(3)" | xref | username_of_poster "JMcGouran" | xref | group_of_poster "" | xref | date_time_posted "2011-07-01 13:27:56" | xref | date_time_modified "2011-07-11 11:26:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1260] === UNIMOD:1260 Ub-amide |
null .Term [UNIMOD:1260] [cols="2*"] |
| id | UNIMOD:1260 | name | Ub-amide | def | "Ub amide probe addition." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1260] | comment | Unpublished chemically synthesized protein modification tool. | synonym | "Active site DUB cystine modification with Ub amide probe Trypsin Digestion reminant of Ub amide probe" [] | xref | record_id "1260" | xref | delta_mono_mass "196.108602" | xref | delta_avge_mass "196.2264" | xref | delta_composition "H(14) C(9) N(3) O(2)" | xref | username_of_poster "JMcGouran" | xref | group_of_poster "" | xref | date_time_posted "2011-07-01 13:47:40" | xref | date_time_modified "2011-07-12 14:28:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1261] === UNIMOD:1261 Ub-fluorescein |
null .Term [UNIMOD:1261] [cols="2*"] |
| id | UNIMOD:1261 | name | Ub-fluorescein | def | "Ub Fluorescein probe addition." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1261] | comment | Unpublished chemically synthesized protein modification tool. | synonym | "Active site DUB cystine modification with Fluorescein Ub probe Trypsin Digestion reminant of Ub Fluorescein probe" [] | xref | record_id "1261" | xref | delta_mono_mass "597.209772" | xref | delta_avge_mass "597.598" | xref | delta_composition "H(29) C(31) N(6) O(7)" | xref | username_of_poster "JMcGouran" | xref | group_of_poster "" | xref | date_time_posted "2011-07-01 13:49:56" | xref | date_time_modified "2011-07-12 14:28:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1262] === UNIMOD:1262 2-dimethylsuccinyl |
null .Term [UNIMOD:1262] [cols="2*"] |
| id | UNIMOD:1262 | name | 2-dimethylsuccinyl | def | "S-(2-dimethylsuccinyl) cysteine." [PMID:http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=637568&loc=ec_rcs, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1262] | xref | record_id "1262" | xref | delta_mono_mass "144.042259" | xref | delta_avge_mass "144.1253" | xref | delta_composition "H(8) C(6) O(4)" | xref | username_of_poster "JMcGouran" | xref | group_of_poster "" | xref | date_time_posted "2011-07-06 10:55:02" | xref | date_time_modified "2011-07-12 14:25:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1263] === UNIMOD:1263 Gly |
null .Term [UNIMOD:1263] [cols="2*"] |
| id | UNIMOD:1263 | name | Gly | def | "Addition of Glycine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1263] | xref | record_id "1263" | xref | delta_mono_mass "57.021464" | xref | delta_avge_mass "57.0513" | xref | delta_composition "H(3) C(2) N O" | xref | username_of_poster "kstampe2" | xref | group_of_poster "" | xref | date_time_posted "2011-07-07 16:37:10" | xref | date_time_modified "2011-07-09 09:33:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Other" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1264] === UNIMOD:1264 pupylation |
null .Term [UNIMOD:1264] [cols="2*"] |
| id | UNIMOD:1264 | name | pupylation | def | "Addition of GGE." [PMID:21738222, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1264] | xref | record_id "1264" | xref | delta_mono_mass "243.085521" | xref | delta_avge_mass "243.2166" | xref | delta_composition "H(13) C(9) N(3) O(5)" | xref | username_of_poster "hbromage" | xref | group_of_poster "" | xref | date_time_posted "2011-07-13 21:34:29" | xref | date_time_modified "2011-07-24 12:24:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1266] === UNIMOD:1266 Label:13C(4) |
null .Term [UNIMOD:1266] [cols="2*"] |
| id | UNIMOD:1266 | name | Label:13C(4) | def | "13C4 Methionine label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1266] | synonym | "SILAC" [] | xref | record_id "1266" | xref | delta_mono_mass "4.013419" | xref | delta_avge_mass "3.9706" | xref | delta_composition "C(-4) 13C(4)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-07-27 09:55:40" | xref | date_time_modified "2011-12-07 10:49:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1267] === UNIMOD:1267 Label:13C(4)+Oxidation |
null .Term [UNIMOD:1267] [cols="2*"] |
| id | UNIMOD:1267 | name | Label:13C(4)+Oxidation | def | "Oxidised 13C4 labelled Methionine." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1267] | synonym | "SILAC" [] | xref | record_id "1267" | xref | delta_mono_mass "20.008334" | xref | delta_avge_mass "19.97" | xref | delta_composition "C(-4) 13C(4) O" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-07-27 10:10:30" | xref | date_time_modified "2011-08-05 14:17:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1270] === UNIMOD:1270 HCysThiolactone |
null .Term [UNIMOD:1270] [cols="2*"] |
| id | UNIMOD:1270 | name | HCysThiolactone | def | "N-Homocysteine thiolactone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1270] | xref | record_id "1270" | xref | delta_mono_mass "117.024835" | xref | delta_avge_mass "117.1695" | xref | delta_composition "H(7) C(4) N O S" | xref | username_of_poster "alejandro" | xref | group_of_poster "" | xref | date_time_posted "2011-09-15 19:31:10" | xref | date_time_modified "2014-12-01 10:35:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_misc_notes "N-Homocysteine thiolactone is an acylating agent and can react with the E amino group of lysine residues" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1271] === UNIMOD:1271 HCysteinyl |
null .Term [UNIMOD:1271] [cols="2*"] |
| id | UNIMOD:1271 | name | HCysteinyl | def | "S-homocysteinylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1271] | xref | record_id "1271" | xref | delta_mono_mass "133.019749" | xref | delta_avge_mass "133.1689" | xref | delta_composition "H(7) C(4) N O(2) S" | xref | username_of_poster "alejandro" | xref | group_of_poster "" | xref | date_time_posted "2011-09-15 19:36:44" | xref | date_time_modified "2011-09-23 16:33:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_1_misc_notes "Homocysteine can take part in disulfide exchange reactions with S-S bonds in proteins, thus forming S-homocysteinylated proteins" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1276] === UNIMOD:1276 UgiJoullie |
null .Term [UNIMOD:1276] [cols="2*"] |
| id | UNIMOD:1276 | name | UgiJoullie | def | "Side reaction of HisTag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1276] | comment | Side product of the three component Ugi-Joullie reaction. Pirrolidine is reacted with a isocianide modificated peptide (CNGGHHHHHH) to get a Pro-Gly-GGHHHHHH. The main product is the C-terminal modified protein. Unlikely Asp and Glu can react. | xref | record_id "1276" | xref | delta_mono_mass "1106.48935" | xref | delta_avge_mass "1107.1274" | xref | delta_composition "H(60) C(47) N(23) O(10)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-09-26 12:42:53" | xref | date_time_modified "2011-09-30 12:38:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1277] === UNIMOD:1277 Dipyridyl |
null .Term [UNIMOD:1277] [cols="2*"] |
| id | UNIMOD:1277 | name | Dipyridyl | def | "Cys modified with dipy ligand." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1277] | comment | Cysteine residue reacts with a chlorinated dipyridyl ligand to get a monoalkylated Cys-L1. The only product is this single cys mutant modified on that position. | xref | record_id "1277" | xref | delta_mono_mass "225.090212" | xref | delta_avge_mass "225.2459" | xref | delta_composition "H(11) C(13) N(3) O" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-09-27 18:33:34" | xref | date_time_modified "2012-01-20 14:46:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1278] === UNIMOD:1278 Furan |
null .Term [UNIMOD:1278] [cols="2*"] |
| id | UNIMOD:1278 | name | Furan | def | "Chemical modification of the iodinated sites of thyroglobulin by Suzuki reaction." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1278] | xref | record_id "1278" | xref | delta_mono_mass "66.010565" | xref | delta_avge_mass "66.0581" | xref | delta_composition "H(2) C(4) O" | xref | username_of_poster "chem0303" | xref | group_of_poster "" | xref | date_time_posted "2011-09-28 13:31:35" | xref | date_time_modified "2011-09-30 12:39:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1279] === UNIMOD:1279 Difuran |
null .Term [UNIMOD:1279] [cols="2*"] |
| id | UNIMOD:1279 | name | Difuran | def | "Chemical modification of the diiodinated sites of thyroglobulin by Suzuki reaction." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1279] | xref | record_id "1279" | xref | delta_mono_mass "132.021129" | xref | delta_avge_mass "132.1162" | xref | delta_composition "H(4) C(8) O(2)" | xref | username_of_poster "chem0303" | xref | group_of_poster "" | xref | date_time_posted "2011-09-28 13:34:45" | xref | date_time_modified "2011-09-30 12:40:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1281] === UNIMOD:1281 BMP-piperidinol |
null .Term [UNIMOD:1281] [cols="2*"] |
| id | UNIMOD:1281 | name | BMP-piperidinol | def | "1-methyl-3-benzoyl-4-hydroxy-4-phenylpiperidine." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/11869872, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1281] | synonym | "(4-hydroxy-1-methyl-4-phenylpiperidin-3-yl)(phenyl)methanone 3-benzoyl-1-methyl-4-phenyl-4-piperidinol" [] | xref | record_id "1281" | xref | delta_mono_mass "263.131014" | xref | delta_avge_mass "263.3337" | xref | delta_composition "H(17) C(18) N O" | xref | username_of_poster "Areej" | xref | group_of_poster "" | xref | date_time_posted "2011-10-12 12:22:26" | xref | date_time_modified "2012-01-13 15:44:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1282] === UNIMOD:1282 UgiJoullieProGly |
null .Term [UNIMOD:1282] [cols="2*"] |
| id | UNIMOD:1282 | name | UgiJoullieProGly | def | "Side reaction of PG with Side chain of aspartic or glutamic acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1282] | comment | Side product of the three component Ugi-Joullie reaction. Pirrolidine is reacted with a isocianide modificated glycine to get Protein-Pro-Gly. The main product is the C-terminal modified protein. Unlikely Asp and Glu can react. | xref | record_id "1282" | xref | delta_mono_mass "154.074228" | xref | delta_avge_mass "154.1665" | xref | delta_composition "H(10) C(7) N(2) O(2)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-10-14 18:11:28" | xref | date_time_modified "2011-10-21 16:41:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1283] === UNIMOD:1283 UgiJoullieProGlyProGly |
null .Term [UNIMOD:1283] [cols="2*"] |
| id | UNIMOD:1283 | name | UgiJoullieProGlyProGly | def | "Side reaction of PGPG with Side chain of aspartic or glutamic acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1283] | comment | Side product of the three component Ugi-Joullie reaction. Pirrolidine is reacted with a isocianide modificated glycine to get Protein-Pro-Gly-Pro-Gly. The main product is the C-terminal modified protein. Unlikely Asp and Glu can react. | xref | record_id "1283" | xref | delta_mono_mass "308.148455" | xref | delta_avge_mass "308.333" | xref | delta_composition "H(20) C(14) N(4) O(4)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-10-14 18:14:19" | xref | date_time_modified "2011-10-21 16:40:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1286] === UNIMOD:1286 IMEHex(2)NeuAc(1) |
null .Term [UNIMOD:1286] [cols="2*"] |
| id | UNIMOD:1286 | name | IMEHex(2)NeuAc(1) | def | "Glycosylation with IME linked Hex(2) NeuAc." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1286] | comment | Modification by Hex(2) NeuAc using IME coupling to get glycosylated proteins. | synonym | "(2-Imino-2-methoxyethyl 1-thioglycoside)" [] | xref | record_id "1286" | xref | delta_mono_mass "688.199683" | xref | delta_avge_mass "688.6527" | xref | delta_composition "H(3) C(2) N S Hex(2) NeuAc" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2011-11-11 12:06:36" | xref | date_time_modified "2015-05-01 14:20:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1287] === UNIMOD:1287 Arg-loss |
null .Term [UNIMOD:1287] [cols="2*"] |
| id | UNIMOD:1287 | name | Arg-loss | def | "Loss of arginine due to transpeptidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1287] | xref | record_id "1287" | xref | delta_mono_mass "-156.101111" | xref | delta_avge_mass "-156.1857" | xref | delta_composition "H(-12) C(-6) N(-4) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 10:12:18" | xref | date_time_modified "2011-11-24 16:39:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1288] === UNIMOD:1288 Arg |
null .Term [UNIMOD:1288] [cols="2*"] |
| id | UNIMOD:1288 | name | Arg | def | "Addition of arginine due to transpeptidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1288] | xref | record_id "1288" | xref | delta_mono_mass "156.101111" | xref | delta_avge_mass "156.1857" | xref | delta_composition "H(12) C(6) N(4) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 10:15:00" | xref | date_time_modified "2011-11-21 10:17:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1289] === UNIMOD:1289 Butyryl |
null .Term [UNIMOD:1289] [cols="2*"] |
| id | UNIMOD:1289 | name | Butyryl | def | "Butyryl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1289] | xref | record_id "1289" | xref | delta_mono_mass "70.041865" | xref | delta_avge_mass "70.0898" | xref | delta_composition "H(6) C(4) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 12:06:20" | xref | date_time_modified "2011-11-21 12:06:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1290] === UNIMOD:1290 Dicarbamidomethyl |
null .Term [UNIMOD:1290] [cols="2*"] |
| id | UNIMOD:1290 | name | Dicarbamidomethyl | def | "Double Carbamidomethylation." [PMID:18511913, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1290] | comment | Mentioned by Marshall Bern. | xref | record_id "1290" | xref | delta_mono_mass "114.042927" | xref | delta_avge_mass "114.1026" | xref | delta_composition "H(6) C(4) N(2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 13:21:06" | xref | date_time_modified "2013-05-16 10:59:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Artefact" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "R" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Artefact" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "N-term" | xref | spec_5_position "Any N-term" | xref | spec_5_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1291] === UNIMOD:1291 Dimethyl:2H(6) |
null .Term [UNIMOD:1291] [cols="2*"] |
| id | UNIMOD:1291 | name | Dimethyl:2H(6) | def | "Dimethyl-Medium." [PMID:15782174, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1291] | xref | record_id "1291" | xref | delta_mono_mass "34.068961" | xref | delta_avge_mass "34.0901" | xref | delta_composition "H(-2) 2H(6) C(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 13:27:00" | xref | date_time_modified "2013-02-22 12:32:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "R" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1292] === UNIMOD:1292 GGQ |
null .Term [UNIMOD:1292] [cols="2*"] |
| id | UNIMOD:1292 | name | GGQ | def | "SUMOylation leaving GlyGlyGln." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1292] | xref | record_id "1292" | xref | delta_mono_mass "242.101505" | xref | delta_avge_mass "242.2319" | xref | delta_composition "H(14) C(9) N(4) O(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 13:37:45" | xref | date_time_modified "2011-11-21 13:53:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest." | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1293] === UNIMOD:1293 QTGG |
null .Term [UNIMOD:1293] [cols="2*"] |
| id | UNIMOD:1293 | name | QTGG | def | "SUMOylation leaving GlnThrGlyGly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1293] | xref | record_id "1293" | xref | delta_mono_mass "343.149184" | xref | delta_avge_mass "343.3357" | xref | delta_composition "H(21) C(13) N(5) O(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 13:41:32" | xref | date_time_modified "2011-11-25 13:05:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest." | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1296] === UNIMOD:1296 Label:13C(3) |
null .Term [UNIMOD:1296] [cols="2*"] |
| id | UNIMOD:1296 | name | Label:13C(3) | def | "13C3 label for SILAC." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1296] | xref | record_id "1296" | xref | delta_mono_mass "3.010064" | xref | delta_avge_mass "2.978" | xref | delta_composition "C(-3) 13C(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 14:36:18" | xref | date_time_modified "2011-11-21 14:37:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1297] === UNIMOD:1297 Label:13C(3)15N(1) |
null .Term [UNIMOD:1297] [cols="2*"] |
| id | UNIMOD:1297 | name | Label:13C(3)15N(1) | def | "SILAC or AQUA label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, URL:https\://www.thermofisher.com/order/catalog/product/A40010#/A40010, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1297] | xref | record_id "1297" | xref | delta_mono_mass "4.007099" | xref | delta_avge_mass "3.9714" | xref | delta_composition "C(-3) 13C(3) N(-1) 15N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 14:37:53" | xref | date_time_modified "2020-01-09 09:44:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1298] === UNIMOD:1298 Label:13C(4)15N(1) |
null .Term [UNIMOD:1298] [cols="2*"] |
| id | UNIMOD:1298 | name | Label:13C(4)15N(1) | def | "13C4 15N1 label for SILAC." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1298] | xref | record_id "1298" | xref | delta_mono_mass "5.010454" | xref | delta_avge_mass "4.964" | xref | delta_composition "C(-4) 13C(4) N(-1) 15N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 14:40:56" | xref | date_time_modified "2011-11-21 14:40:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1299] === UNIMOD:1299 Label:2H(10) |
null .Term [UNIMOD:1299] [cols="2*"] |
| id | UNIMOD:1299 | name | Label:2H(10) | def | "2H(10) label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1299] | xref | record_id "1299" | xref | delta_mono_mass "10.062767" | xref | delta_avge_mass "10.0616" | xref | delta_composition "H(-10) 2H(10)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 14:51:01" | xref | date_time_modified "2011-11-21 14:51:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "L" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1300] === UNIMOD:1300 Label:2H(4)13C(1) |
null .Term [UNIMOD:1300] [cols="2*"] |
| id | UNIMOD:1300 | name | Label:2H(4)13C(1) | def | "Label:2H(4)13C(1)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1300] | comment | For SILAC experiments. | xref | record_id "1300" | xref | delta_mono_mass "5.028462" | xref | delta_avge_mass "5.0173" | xref | delta_composition "H(-4) 2H(4) C(-1) 13C" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 14:52:54" | xref | date_time_modified "2011-11-21 14:52:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1301] === UNIMOD:1301 Lys |
null .Term [UNIMOD:1301] [cols="2*"] |
| id | UNIMOD:1301 | name | Lys | def | "Addition of lysine due to transpeptidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1301] | xref | record_id "1301" | xref | delta_mono_mass "128.094963" | xref | delta_avge_mass "128.1723" | xref | delta_composition "H(12) C(6) N(2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-21 14:56:07" | xref | date_time_modified "2015-05-06 12:07:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1302] === UNIMOD:1302 mTRAQ:13C(6)15N(2) |
null .Term [UNIMOD:1302] [cols="2*"] |
| id | UNIMOD:1302 | name | mTRAQ:13C(6)15N(2) | def | "MTRAQ heavy." [URL:http\://www3.appliedbiosystems.com/cms/groups/psm_support/documents/generaldocuments/cms_054141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1302] | synonym | "Applied Biosystems mTRAQ™ reagent" [] | xref | record_id "1302" | xref | delta_mono_mass "148.109162" | xref | delta_avge_mass "148.1257" | xref | delta_composition "H(12) C 13C(6) 15N(2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-25 10:35:32" | xref | date_time_modified "2011-11-25 10:35:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "0" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Very low abundance" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_5_misc_notes "Very low abundance" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | xref | spec_6_misc_notes "Very low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1303] === UNIMOD:1303 NeuAc |
null .Term [UNIMOD:1303] [cols="2*"] |
| id | UNIMOD:1303 | name | NeuAc | def | "N-acetyl neuraminic acid." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1303] | xref | record_id "1303" | xref | delta_mono_mass "291.095417" | xref | delta_avge_mass "291.2546" | xref | delta_composition "NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-25 10:40:54" | xref | date_time_modified "2015-05-01 15:11:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_292_mono_mass "291.095417" | xref | spec_1_neutral_loss_292_avge_mass "291.2546" | xref | spec_1_neutral_loss_292_flag "false" | xref | spec_1_neutral_loss_292_composition "NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_292_mono_mass "291.095417" | xref | spec_2_neutral_loss_292_avge_mass "291.2546" | xref | spec_2_neutral_loss_292_flag "false" | xref | spec_2_neutral_loss_292_composition "NeuAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_292_mono_mass "291.095417" | xref | spec_2_neutral_loss_292_avge_mass "291.2546" | xref | spec_2_neutral_loss_292_flag "false" | xref | spec_2_neutral_loss_292_composition "NeuAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1304] === UNIMOD:1304 NeuGc |
null .Term [UNIMOD:1304] [cols="2*"] |
| id | UNIMOD:1304 | name | NeuGc | def | "N-glycoyl neuraminic acid." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1304] | xref | record_id "1304" | xref | delta_mono_mass "307.090331" | xref | delta_avge_mass "307.254" | xref | delta_composition "NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-25 10:41:35" | xref | date_time_modified "2015-05-01 15:13:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_308_mono_mass "307.090331" | xref | spec_1_neutral_loss_308_avge_mass "307.254" | xref | spec_1_neutral_loss_308_flag "false" | xref | spec_1_neutral_loss_308_composition "NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_308_mono_mass "307.090331" | xref | spec_2_neutral_loss_308_avge_mass "307.254" | xref | spec_2_neutral_loss_308_flag "false" | xref | spec_2_neutral_loss_308_composition "NeuGc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_308_mono_mass "307.090331" | xref | spec_2_neutral_loss_308_avge_mass "307.254" | xref | spec_2_neutral_loss_308_flag "false" | xref | spec_2_neutral_loss_308_composition "NeuGc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1305] === UNIMOD:1305 Propyl |
null .Term [UNIMOD:1305] [cols="2*"] |
| id | UNIMOD:1305 | name | Propyl | def | "Propyl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1305] | xref | record_id "1305" | xref | delta_mono_mass "42.04695" | xref | delta_avge_mass "42.0797" | xref | delta_composition "H(6) C(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-25 11:06:09" | xref | date_time_modified "2014-10-17 11:31:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "D" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_3_misc_notes "propyl ester" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "E" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_4_misc_notes "propyl ester" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "C-term" | xref | spec_5_position "Any C-term" | xref | spec_5_classification "Chemical derivative" | xref | spec_5_misc_notes "propyl ester" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "C-term" | xref | spec_6_position "Protein C-term" | xref | spec_6_classification "Chemical derivative" | xref | spec_6_misc_notes "propyl ester" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1306] === UNIMOD:1306 Propyl:2H(6) |
null .Term [UNIMOD:1306] [cols="2*"] |
| id | UNIMOD:1306 | name | Propyl:2H(6) | def | "Propyl:2H(6)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1306] | xref | record_id "1306" | xref | delta_mono_mass "48.084611" | xref | delta_avge_mass "48.1167" | xref | delta_composition "2H(6) C(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2011-11-25 11:06:56" | xref | date_time_modified "2011-11-25 11:06:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1310] === UNIMOD:1310 Propiophenone |
null .Term [UNIMOD:1310] [cols="2*"] |
| id | UNIMOD:1310 | name | Propiophenone | def | "Propiophenone." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/11869872, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1310] | xref | record_id "1310" | xref | delta_mono_mass "132.057515" | xref | delta_avge_mass "132.1592" | xref | delta_composition "H(8) C(9) O" | xref | username_of_poster "Areej" | xref | group_of_poster "" | xref | date_time_posted "2011-12-07 23:43:34" | xref | date_time_modified "2011-12-09 13:50:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "R" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "W" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "C" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1312] === UNIMOD:1312 Delta:H(6)C(3)O(1) |
null .Term [UNIMOD:1312] [cols="2*"] |
| id | UNIMOD:1312 | name | Delta:H(6)C(3)O(1) | def | "Reduced acrolein addition +58." [PMID:21778411, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1312] | xref | record_id "1312" | xref | delta_mono_mass "58.041865" | xref | delta_avge_mass "58.0791" | xref | delta_composition "H(6) C(3) O" | xref | username_of_poster "yiyingzhu" | xref | group_of_poster "" | xref | date_time_posted "2011-12-15 19:38:31" | xref | date_time_modified "2011-12-16 15:11:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N-term" | xref | spec_4_position "Protein N-term" | xref | spec_4_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1313] === UNIMOD:1313 Delta:H(8)C(6)O(1) |
null .Term [UNIMOD:1313] [cols="2*"] |
| id | UNIMOD:1313 | name | Delta:H(8)C(6)O(1) | def | "Reduced acrolein addition +96." [PMID:21778411, PMID:9632657, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1313] | xref | record_id "1313" | xref | delta_mono_mass "96.057515" | xref | delta_avge_mass "96.1271" | xref | delta_composition "H(8) C(6) O" | xref | username_of_poster "yiyingzhu" | xref | group_of_poster "" | xref | date_time_posted "2011-12-15 19:48:15" | xref | date_time_modified "2015-10-12 16:16:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1314] === UNIMOD:1314 biotinAcrolein298 |
null .Term [UNIMOD:1314] [cols="2*"] |
| id | UNIMOD:1314 | name | biotinAcrolein298 | def | "Biotin hydrazide labeled acrolein addition +298." [PMID:21704744, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1314] | xref | record_id "1314" | xref | delta_mono_mass "298.146347" | xref | delta_avge_mass "298.4044" | xref | delta_composition "H(22) C(13) N(4) O(2) S" | xref | username_of_poster "yiyingzhu" | xref | group_of_poster "" | xref | date_time_posted "2011-12-15 19:54:52" | xref | date_time_modified "2011-12-16 15:19:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "N-term" | xref | spec_4_position "Protein N-term" | xref | spec_4_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1315] === UNIMOD:1315 MM-diphenylpentanone |
null .Term [UNIMOD:1315] [cols="2*"] |
| id | UNIMOD:1315 | name | MM-diphenylpentanone | def | "3-methyl-5-(methylamino)-1,3-diphenylpentan-1-one." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/11869872, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1315] | xref | record_id "1315" | xref | delta_mono_mass "265.146664" | xref | delta_avge_mass "265.3496" | xref | delta_composition "H(19) C(18) N O" | xref | username_of_poster "Areej" | xref | group_of_poster "" | xref | date_time_posted "2011-12-21 21:29:00" | xref | date_time_modified "2011-12-21 21:29:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1317] === UNIMOD:1317 EHD-diphenylpentanone |
null .Term [UNIMOD:1317] [cols="2*"] |
| id | UNIMOD:1317 | name | EHD-diphenylpentanone | def | "2-ethyl-3-hydroxy-1,3-diphenylpentan-1-one." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/11869872, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1317] | synonym | "3-benzoyl-1-methyl-4-phenyl-4-piperidinol demethyl damino" [] | xref | record_id "1317" | xref | delta_mono_mass "266.13068" | xref | delta_avge_mass "266.3343" | xref | delta_composition "H(18) C(18) O(2)" | xref | username_of_poster "Areej" | xref | group_of_poster "" | xref | date_time_posted "2012-01-08 15:22:49" | xref | date_time_modified "2012-01-13 15:41:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "M" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1320] === UNIMOD:1320 Biotin:Thermo-21901+2H2O |
null .Term [UNIMOD:1320] [cols="2*"] |
| id | UNIMOD:1320 | name | Biotin:Thermo-21901+2H2O | def | "Maleimide-Biotin + 2Water." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1320] | synonym | "Maleimide-PEG2-Biotin + 2Water" [] | xref | record_id "1320" | xref | delta_mono_mass "561.246849" | xref | delta_avge_mass "561.6489" | xref | delta_composition "H(39) C(23) N(5) O(9) S" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2012-01-23 14:20:11" | xref | date_time_modified "2012-01-27 12:51:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1321] === UNIMOD:1321 DiLeu4plex115 |
null .Term [UNIMOD:1321] [cols="2*"] |
| id | UNIMOD:1321 | name | DiLeu4plex115 | def | "Accurate mass for DiLeu 115 isobaric tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1321] | comment | Different channels have the same nominal mass but slightly different exact masses. | xref | record_id "1321" | xref | delta_mono_mass "145.12" | xref | delta_avge_mass "145.1966" | xref | delta_composition "H(15) C(7) 13C 15N 18O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2012-02-15 12:05:08" | xref | date_time_modified "2012-02-15 12:05:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1322] === UNIMOD:1322 DiLeu4plex |
null .Term [UNIMOD:1322] [cols="2*"] |
| id | UNIMOD:1322 | name | DiLeu4plex | def | "Accurate mass for DiLeu 116 isobaric tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1322] | comment | Different channels have the same nominal mass but slightly different exact masses. | synonym | "Representative, nominal mass for all four tags" [] | xref | record_id "1322" | xref | delta_mono_mass "145.132163" | xref | delta_avge_mass "145.2229" | xref | delta_composition "H(13) 2H(2) C(8) N 18O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2012-02-15 12:05:48" | xref | date_time_modified "2016-09-22 15:14:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1323] === UNIMOD:1323 DiLeu4plex117 |
null .Term [UNIMOD:1323] [cols="2*"] |
| id | UNIMOD:1323 | name | DiLeu4plex117 | def | "Accurate mass for DiLeu 117 isobaric tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1323] | comment | Different channels have the same nominal mass but slightly different exact masses. | xref | record_id "1323" | xref | delta_mono_mass "145.128307" | xref | delta_avge_mass "145.2092" | xref | delta_composition "H(13) 2H(2) C(7) 13C 15N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2012-02-15 12:06:10" | xref | date_time_modified "2012-02-15 12:06:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1324] === UNIMOD:1324 DiLeu4plex118 |
null .Term [UNIMOD:1324] [cols="2*"] |
| id | UNIMOD:1324 | name | DiLeu4plex118 | def | "Accurate mass for DiLeu 118 isobaric tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1324] | comment | Different channels have the same nominal mass but slightly different exact masses. | xref | record_id "1324" | xref | delta_mono_mass "145.140471" | xref | delta_avge_mass "145.2354" | xref | delta_composition "H(11) 2H(4) C(8) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2012-02-15 12:06:30" | xref | date_time_modified "2012-02-15 12:06:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Isotopic label" | xref | spec_3_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1326] === UNIMOD:1326 NEMsulfur |
null .Term [UNIMOD:1326] [cols="2*"] |
| id | UNIMOD:1326 | name | NEMsulfur | def | "N-ethylmaleimideSulfur." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1326] | synonym | "NEMS" [] | xref | record_id "1326" | xref | delta_mono_mass "157.019749" | xref | delta_avge_mass "157.1903" | xref | delta_composition "H(7) C(6) N O(2) S" | xref | username_of_poster "Raghothama" | xref | group_of_poster "" | xref | date_time_posted "2012-02-29 17:06:24" | xref | date_time_modified "2012-03-09 11:26:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1327] === UNIMOD:1327 SulfurDioxide |
null .Term [UNIMOD:1327] [cols="2*"] |
| id | UNIMOD:1327 | name | SulfurDioxide | def | "SulfurDioxide." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/21740851, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1327] | xref | record_id "1327" | xref | delta_mono_mass "63.9619" | xref | delta_avge_mass "64.0638" | xref | delta_composition "O(2) S" | xref | username_of_poster "Raghothama" | xref | group_of_poster "" | xref | date_time_posted "2012-02-29 17:24:24" | xref | date_time_modified "2012-03-09 11:25:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1328] === UNIMOD:1328 NEMsulfurWater |
null .Term [UNIMOD:1328] [cols="2*"] |
| id | UNIMOD:1328 | name | NEMsulfurWater | def | "N-ethylmaleimideSulfurWater." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1328] | synonym | "NEMSwater" [] | xref | record_id "1328" | xref | delta_mono_mass "175.030314" | xref | delta_avge_mass "175.2056" | xref | delta_composition "H(9) C(6) N O(3) S" | xref | username_of_poster "Raghothama" | xref | group_of_poster "" | xref | date_time_posted "2012-02-29 17:25:30" | xref | date_time_modified "2012-03-09 11:24:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1330] === UNIMOD:1330 bisANS-sulfonates |
null .Term [UNIMOD:1330] [cols="2*"] |
| id | UNIMOD:1330 | name | bisANS-sulfonates | def | "BisANS with loss of both sulfonates." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1330] | xref | record_id "1330" | xref | delta_mono_mass "437.201774" | xref | delta_avge_mass "437.5543" | xref | delta_composition "H(25) C(32) N(2)" | xref | username_of_poster "app95d" | xref | group_of_poster "" | xref | date_time_posted "2012-05-22 21:55:58" | xref | date_time_modified "2012-05-29 12:07:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1331] === UNIMOD:1331 DNCB_hapten |
null .Term [UNIMOD:1331] [cols="2*"] |
| id | UNIMOD:1331 | name | DNCB_hapten | def | "Chemical reaction with 2,4-dinitro-1-chloro benzene (DNCB)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1331] | comment | Chemical reaction with 2,4-dinitro-1-chloro benzene (DNCB) by nucleophilic attack on electrophilic amino acid side chains. | xref | record_id "1331" | xref | delta_mono_mass "166.001457" | xref | delta_avge_mass "166.0911" | xref | delta_composition "H(2) C(6) N(2) O(4)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2012-05-24 13:55:30" | xref | date_time_modified "2012-08-03 09:19:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "Y" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1340] === UNIMOD:1340 Biotin:Thermo-21911 |
null .Term [UNIMOD:1340] [cols="2*"] |
| id | UNIMOD:1340 | name | Biotin:Thermo-21911 | def | "Biotin-PEG11-maleimide." [URL:http\://www.piercenet.com/browse.cfm?fldID=E3862D31-9A5C-4F0A-9879-F600D33BD926, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1340] | synonym | "Thermo #21911" [] | xref | record_id "1340" | xref | delta_mono_mass "921.461652" | xref | delta_avge_mass "922.0913" | xref | delta_composition "H(71) C(41) N(5) O(16) S" | xref | username_of_poster "Jolein_Gloerich" | xref | group_of_poster "" | xref | date_time_posted "2012-06-26 17:49:31" | xref | date_time_modified "2012-07-14 19:02:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1341] === UNIMOD:1341 iodoTMT |
null .Term [UNIMOD:1341] [cols="2*"] |
| id | UNIMOD:1341 | name | iodoTMT | def | "Native iodoacetyl Tandem Mass Tag®." [URL:http\://www.lifetechnologies.com/order/catalog/product/90100, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1341] | comment | This modification describes the native iodoTMT Reagent without isotopic label. Upon CID, this reagent releases a reporter ion of 126.127725(monoisotopic mass). | synonym | "iodoTMTzero iodoTMT0 Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] | xref | record_id "1341" | xref | delta_mono_mass "324.216141" | xref | delta_avge_mass "324.4185" | xref | delta_composition "H(28) C(16) N(4) O(3)" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2012-07-06 17:37:43" | xref | date_time_modified "2015-04-20 16:12:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "E" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "K" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1342] === UNIMOD:1342 iodoTMT6plex |
null .Term [UNIMOD:1342] [cols="2*"] |
| id | UNIMOD:1342 | name | iodoTMT6plex | def | "Sixplex iodoacetyl Tandem Mass Tag®." [URL:http\://www.lifetechnologies.com/order/catalog/product/90102, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1342] | comment | This modification describes the native iodoTMT Reagent without isotopic label. Upon CID, this reagent releases a reporter ions of 126.127725, 127.124760, 128.134433, 129.131468, 130.141141, and 131.138176 (monoisotopic mass). | synonym | "iodoTMTsixplex iodoTMT6 Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] | xref | record_id "1342" | xref | delta_mono_mass "329.226595" | xref | delta_avge_mass "329.3825" | xref | delta_composition "H(28) C(12) 13C(4) N(3) 15N O(3)" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2012-07-06 17:43:59" | xref | date_time_modified "2015-04-20 16:13:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "D" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "E" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "K" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1344] === UNIMOD:1344 Phosphogluconoylation |
null .Term [UNIMOD:1344] [cols="2*"] |
| id | UNIMOD:1344 | name | Phosphogluconoylation | def | "Phosphogluconoylation." [URL:http\://www.abrf.org/index.cfm/dm.details?DMID=275&AvgMass=258&Margin=0, PMID:18083862, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1344] | xref | record_id "1344" | xref | delta_mono_mass "258.014069" | xref | delta_avge_mass "258.1199" | xref | delta_composition "H(11) C(6) O(9) P" | xref | username_of_poster "gwadams" | xref | group_of_poster "" | xref | date_time_posted "2012-07-13 14:40:15" | xref | date_time_modified "2013-05-22 10:55:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1345] === UNIMOD:1345 PS_Hapten |
null .Term [UNIMOD:1345] [cols="2*"] |
| id | UNIMOD:1345 | name | PS_Hapten | def | "Reaction with phenyl salicylate (PS)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1345] | xref | record_id "1345" | xref | delta_mono_mass "120.021129" | xref | delta_avge_mass "120.1055" | xref | delta_composition "H(4) C(7) O(2)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2012-08-01 14:45:32" | xref | date_time_modified "2012-08-03 09:20:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1348] === UNIMOD:1348 Cy3-maleimide |
null .Term [UNIMOD:1348] [cols="2*"] |
| id | UNIMOD:1348 | name | Cy3-maleimide | def | "Cy3 Maleimide mono-Reactive dye." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1348] | synonym | "Cy3 mono-functional maleimides are used for the selective labeling of molecules containing free sulfhydryl groups, such as cysteine residues in proteins and peptides and oligonucleotides." [] | xref | record_id "1348" | xref | delta_mono_mass "753.262796" | xref | delta_avge_mass "753.9046" | xref | delta_composition "H(45) C(37) N(4) O(9) S(2)" | xref | username_of_poster "hbromage" | xref | group_of_poster "" | xref | date_time_posted "2012-08-27 21:50:06" | xref | date_time_modified "2015-01-02 09:46:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1349] === UNIMOD:1349 benzylguanidine |
null .Term [UNIMOD:1349] [cols="2*"] |
| id | UNIMOD:1349 | name | benzylguanidine | def | "Modification of the lysine side chain from NH2 to guanidine with a H removed in favor of a benzyl group." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1349] | synonym | "adds 132 Da to K side chain" [] | xref | record_id "1349" | xref | delta_mono_mass "132.068748" | xref | delta_avge_mass "132.1625" | xref | delta_composition "H(8) C(8) N(2)" | xref | username_of_poster "pepinr" | xref | group_of_poster "" | xref | date_time_posted "2012-09-06 17:14:04" | xref | date_time_modified "2012-09-07 15:15:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1350] === UNIMOD:1350 CarboxymethylDMAP |
null .Term [UNIMOD:1350] [cols="2*"] |
| id | UNIMOD:1350 | name | CarboxymethylDMAP | def | "A fixed +1 charge tag attached to the N-terminus of peptides." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1350] | synonym | "Added mass is reduced by 1 H to reflect that first charge state requires no proton addition Replaces one of the N-terminal H atoms with C9H12N2O" [] | xref | record_id "1350" | xref | delta_mono_mass "162.079313" | xref | delta_avge_mass "162.1885" | xref | delta_composition "H(10) C(9) N(2) O" | xref | username_of_poster "pepinr" | xref | group_of_poster "" | xref | date_time_posted "2012-09-06 17:32:42" | xref | date_time_modified "2012-09-07 15:19:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1355] === UNIMOD:1355 azole |
null .Term [UNIMOD:1355] [cols="2*"] |
| id | UNIMOD:1355 | name | azole | def | "Formation of five membered aromatic heterocycle." [PMID:15883371, PMID:8895467, PMID:10200165, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1355] | xref | record_id "1355" | xref | delta_mono_mass "-20.026215" | xref | delta_avge_mass "-20.0312" | xref | delta_composition "H(-4) O(-1)" | xref | username_of_poster "jomcintosh" | xref | group_of_poster "" | xref | date_time_posted "2012-09-10 17:32:20" | xref | date_time_modified "2012-09-15 00:33:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1356] === UNIMOD:1356 phosphoRibosyl |
null .Term [UNIMOD:1356] [cols="2*"] |
| id | UNIMOD:1356 | name | phosphoRibosyl | def | "Phosphate-ribosylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1356] | xref | record_id "1356" | xref | delta_mono_mass "212.00859" | xref | delta_avge_mass "212.0945" | xref | delta_composition "H(9) C(5) O(7) P" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2012-09-19 14:16:08" | xref | date_time_modified "2015-04-29 11:15:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "R" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1358] === UNIMOD:1358 NEM:2H(5)+H2O |
null .Term [UNIMOD:1358] [cols="2*"] |
| id | UNIMOD:1358 | name | NEM:2H(5)+H2O | def | "D5 N-ethylmaleimide+water on cysteines." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1358] | comment | Lab based observation that D5 NEM hydrolyses in an analogous way to NEM. | synonym | "CysNEM D5 hydrolised" [] | xref | record_id "1358" | xref | delta_mono_mass "148.089627" | xref | delta_avge_mass "148.1714" | xref | delta_composition "H(4) 2H(5) C(6) N O(3)" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2012-10-16 17:45:04" | xref | date_time_modified "2012-11-02 16:22:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1363] === UNIMOD:1363 Crotonyl |
null .Term [UNIMOD:1363] [cols="2*"] |
| id | UNIMOD:1363 | name | Crotonyl | def | "Crotonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1363] | xref | record_id "1363" | xref | delta_mono_mass "68.026215" | xref | delta_avge_mass "68.074" | xref | delta_composition "H(4) C(4) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2012-12-24 15:50:10" | xref | date_time_modified "2017-10-09 15:45:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1364] === UNIMOD:1364 O-Et-N-diMePhospho |
null .Term [UNIMOD:1364] [cols="2*"] |
| id | UNIMOD:1364 | name | O-Et-N-diMePhospho | def | "O-ethyl, N-dimethyl phosphate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1364] | comment | Adduct formed upon reaction of the organophosphate tabun with the active site serine of serine esterases/proteases such as butyrylcholinestease. | synonym | "tabun" [] | xref | record_id "1364" | xref | delta_mono_mass "135.044916" | xref | delta_avge_mass "135.1015" | xref | delta_composition "H(10) C(4) N O(2) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2013-01-27 13:26:33" | xref | date_time_modified "2013-02-07 16:50:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1365] === UNIMOD:1365 N-dimethylphosphate |
null .Term [UNIMOD:1365] [cols="2*"] |
| id | UNIMOD:1365 | name | N-dimethylphosphate | def | "N-dimethylphosphate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1365] | comment | This adduct is a consequence of hydrolysis of the initial adduct formed by tabun (aging) on the active site serine of serine esterases/proteases such as butyrylcholinesterase. | synonym | "aged tabun" [] | xref | record_id "1365" | xref | delta_mono_mass "107.013615" | xref | delta_avge_mass "107.0483" | xref | delta_composition "H(6) C(2) N O(2) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2013-01-27 13:36:32" | xref | date_time_modified "2013-02-07 16:49:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1367] === UNIMOD:1367 dHex(1)Hex(1) |
null .Term [UNIMOD:1367] [cols="2*"] |
| id | UNIMOD:1367 | name | dHex(1)Hex(1) | def | "Hex1dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1367] | xref | record_id "1367" | xref | delta_mono_mass "308.110732" | xref | delta_avge_mass "308.2818" | xref | delta_composition "dHex Hex" | xref | username_of_poster "dfplazag" | xref | group_of_poster "" | xref | date_time_posted "2013-02-07 14:29:21" | xref | date_time_modified "2015-05-01 15:14:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_309_mono_mass "308.110732" | xref | spec_1_neutral_loss_309_avge_mass "308.2818" | xref | spec_1_neutral_loss_309_flag "false" | xref | spec_1_neutral_loss_309_composition "dHex Hex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_309_mono_mass "308.110732" | xref | spec_1_neutral_loss_309_avge_mass "308.2818" | xref | spec_1_neutral_loss_309_flag "false" | xref | spec_1_neutral_loss_309_composition "dHex Hex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1368] === UNIMOD:1368 Methyl:2H(3)+Acetyl:2H(3) |
null .Term [UNIMOD:1368] [cols="2*"] |
| id | UNIMOD:1368 | name | Methyl:2H(3)+Acetyl:2H(3) | def | "3-fold methylated lysine labelled with Acetyl_heavy." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1368] | xref | record_id "1368" | xref | delta_mono_mass "62.063875" | xref | delta_avge_mass "62.1002" | xref | delta_composition "H(-2) 2H(6) C(3) O" | xref | username_of_poster "Plank" | xref | group_of_poster "" | xref | date_time_posted "2013-02-14 16:21:54" | xref | date_time_modified "2013-02-14 16:21:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1370] === UNIMOD:1370 Label:2H(3)+Oxidation |
null .Term [UNIMOD:1370] [cols="2*"] |
| id | UNIMOD:1370 | name | Label:2H(3)+Oxidation | def | "Oxidised 2H(3) labelled Methionine." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1370] | synonym | "SILAC" [] | xref | record_id "1370" | xref | delta_mono_mass "19.013745" | xref | delta_avge_mass "19.0179" | xref | delta_composition "H(-3) 2H(3) O" | xref | username_of_poster "Plank" | xref | group_of_poster "" | xref | date_time_posted "2013-02-14 16:36:56" | xref | date_time_modified "2013-02-22 12:39:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1371] === UNIMOD:1371 Trimethyl:2H(9) |
null .Term [UNIMOD:1371] [cols="2*"] |
| id | UNIMOD:1371 | name | Trimethyl:2H(9) | def | "3-fold methylation with deuterated methyl groups." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1371] | xref | record_id "1371" | xref | delta_mono_mass "51.103441" | xref | delta_avge_mass "51.1352" | xref | delta_composition "H(-3) 2H(9) C(3)" | xref | username_of_poster "Plank" | xref | group_of_poster "" | xref | date_time_posted "2013-02-14 17:14:16" | xref | date_time_modified "2013-02-22 12:37:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1372] === UNIMOD:1372 Acetyl:13C(2) |
null .Term [UNIMOD:1372] [cols="2*"] |
| id | UNIMOD:1372 | name | Acetyl:13C(2) | def | "Heavy acetylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1372] | xref | record_id "1372" | xref | delta_mono_mass "44.017274" | xref | delta_avge_mass "44.022" | xref | delta_composition "H(2) 13C(2) O" | xref | username_of_poster "Plank" | xref | group_of_poster "" | xref | date_time_posted "2013-02-14 17:24:23" | xref | date_time_modified "2013-02-14 17:24:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1375] === UNIMOD:1375 dHex(1)Hex(2) |
null .Term [UNIMOD:1375] [cols="2*"] |
| id | UNIMOD:1375 | name | dHex(1)Hex(2) | def | "Hex2dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1375] | xref | record_id "1375" | xref | delta_mono_mass "470.163556" | xref | delta_avge_mass "470.4224" | xref | delta_composition "dHex Hex(2)" | xref | username_of_poster "dfplazag" | xref | group_of_poster "" | xref | date_time_posted "2013-04-10 14:57:30" | xref | date_time_modified "2015-05-01 15:18:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_471_mono_mass "470.163556" | xref | spec_1_neutral_loss_471_avge_mass "470.4224" | xref | spec_1_neutral_loss_471_flag "false" | xref | spec_1_neutral_loss_471_composition "dHex Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_471_mono_mass "470.163556" | xref | spec_1_neutral_loss_471_avge_mass "470.4224" | xref | spec_1_neutral_loss_471_flag "false" | xref | spec_1_neutral_loss_471_composition "dHex Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1376] === UNIMOD:1376 dHex(1)Hex(3) |
null .Term [UNIMOD:1376] [cols="2*"] |
| id | UNIMOD:1376 | name | dHex(1)Hex(3) | def | "Hex3dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1376] | xref | record_id "1376" | xref | delta_mono_mass "632.216379" | xref | delta_avge_mass "632.563" | xref | delta_composition "dHex Hex(3)" | xref | username_of_poster "dfplazag" | xref | group_of_poster "" | xref | date_time_posted "2013-04-10 15:00:23" | xref | date_time_modified "2015-05-01 15:24:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_633_mono_mass "632.216379" | xref | spec_1_neutral_loss_633_avge_mass "632.563" | xref | spec_1_neutral_loss_633_flag "false" | xref | spec_1_neutral_loss_633_composition "dHex Hex(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_633_mono_mass "632.216379" | xref | spec_1_neutral_loss_633_avge_mass "632.563" | xref | spec_1_neutral_loss_633_flag "false" | xref | spec_1_neutral_loss_633_composition "dHex Hex(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1377] === UNIMOD:1377 dHex(1)Hex(4) |
null .Term [UNIMOD:1377] [cols="2*"] |
| id | UNIMOD:1377 | name | dHex(1)Hex(4) | def | "Hex4dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1377] | xref | record_id "1377" | xref | delta_mono_mass "794.269203" | xref | delta_avge_mass "794.7036" | xref | delta_composition "dHex Hex(4)" | xref | username_of_poster "dfplazag" | xref | group_of_poster "" | xref | date_time_posted "2013-04-10 15:01:35" | xref | date_time_modified "2015-05-01 15:27:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_795_mono_mass "794.269203" | xref | spec_1_neutral_loss_795_avge_mass "794.7036" | xref | spec_1_neutral_loss_795_flag "false" | xref | spec_1_neutral_loss_795_composition "dHex Hex(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_795_mono_mass "794.269203" | xref | spec_1_neutral_loss_795_avge_mass "794.7036" | xref | spec_1_neutral_loss_795_flag "false" | xref | spec_1_neutral_loss_795_composition "dHex Hex(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1378] === UNIMOD:1378 dHex(1)Hex(5) |
null .Term [UNIMOD:1378] [cols="2*"] |
| id | UNIMOD:1378 | name | dHex(1)Hex(5) | def | "Hex5dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1378] | xref | record_id "1378" | xref | delta_mono_mass "956.322026" | xref | delta_avge_mass "956.8442" | xref | delta_composition "dHex Hex(5)" | xref | username_of_poster "dfplazag" | xref | group_of_poster "" | xref | date_time_posted "2013-04-10 15:03:12" | xref | date_time_modified "2015-05-01 15:43:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_957_mono_mass "956.322026" | xref | spec_1_neutral_loss_957_avge_mass "956.8442" | xref | spec_1_neutral_loss_957_flag "false" | xref | spec_1_neutral_loss_957_composition "dHex Hex(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_957_mono_mass "956.322026" | xref | spec_1_neutral_loss_957_avge_mass "956.8442" | xref | spec_1_neutral_loss_957_flag "false" | xref | spec_1_neutral_loss_957_composition "dHex Hex(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1379] === UNIMOD:1379 dHex(1)Hex(6) |
null .Term [UNIMOD:1379] [cols="2*"] |
| id | UNIMOD:1379 | name | dHex(1)Hex(6) | def | "Hex6dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1379] | xref | record_id "1379" | xref | delta_mono_mass "1118.37485" | xref | delta_avge_mass "1118.9848" | xref | delta_composition "dHex Hex(6)" | xref | username_of_poster "dfplazag" | xref | group_of_poster "" | xref | date_time_posted "2013-04-10 15:04:22" | xref | date_time_modified "2015-05-01 15:44:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1119_mono_mass "1118.37485" | xref | spec_1_neutral_loss_1119_avge_mass "1118.9848" | xref | spec_1_neutral_loss_1119_flag "false" | xref | spec_1_neutral_loss_1119_composition "dHex Hex(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1119_mono_mass "1118.37485" | xref | spec_1_neutral_loss_1119_avge_mass "1118.9848" | xref | spec_1_neutral_loss_1119_flag "false" | xref | spec_1_neutral_loss_1119_composition "dHex Hex(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1380] === UNIMOD:1380 methylsulfonylethyl |
null .Term [UNIMOD:1380] [cols="2*"] |
| id | UNIMOD:1380 | name | methylsulfonylethyl | def | "Reaction with methyl vinyl sulfone." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/?term=2475130, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1380] | synonym | "protein alkylation by Michael acceptor methyl vinyl sulfone" [] | xref | record_id "1380" | xref | delta_mono_mass "106.00885" | xref | delta_avge_mass "106.1435" | xref | delta_composition "H(6) C(3) O(2) S" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2013-04-24 14:30:59" | xref | date_time_modified "2013-05-02 10:13:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1381] === UNIMOD:1381 ethylsulfonylethyl |
null .Term [UNIMOD:1381] [cols="2*"] |
| id | UNIMOD:1381 | name | ethylsulfonylethyl | def | "Reaction with ethyl vinyl sulfone." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/2475130, PMID:http://www.ncbi.nlm.nih.gov/pubmed/1242713, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1381] | synonym | "protein alkylation by Michael acceptor ethyl vinyl sulfone" [] | xref | record_id "1381" | xref | delta_mono_mass "120.0245" | xref | delta_avge_mass "120.1701" | xref | delta_composition "H(8) C(4) O(2) S" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2013-04-24 14:36:48" | xref | date_time_modified "2013-04-26 09:25:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1382] === UNIMOD:1382 phenylsulfonylethyl |
null .Term [UNIMOD:1382] [cols="2*"] |
| id | UNIMOD:1382 | name | phenylsulfonylethyl | def | "Reaction with phenyl vinyl sulfone." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/18528979, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1382] | synonym | "protein alkylation by Michael acceptor phenyl vinyl sulfone" [] | xref | record_id "1382" | xref | delta_mono_mass "168.0245" | xref | delta_avge_mass "168.2129" | xref | delta_composition "H(8) C(8) O(2) S" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2013-04-24 14:41:29" | xref | date_time_modified "2013-04-26 09:25:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1383] === UNIMOD:1383 PyridoxalPhosphateH2 |
null .Term [UNIMOD:1383] [cols="2*"] |
| id | UNIMOD:1383 | name | PyridoxalPhosphateH2 | def | "PLP bound to lysine reduced by sodium borohydride (NaBH4) to create amine linkage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1383] | synonym | "Pyridoxal Phosphate reduced" [] | xref | record_id "1383" | xref | delta_mono_mass "231.02966" | xref | delta_avge_mass "231.1425" | xref | delta_composition "H(10) C(8) N O(5) P" | xref | username_of_poster "bphilmus" | xref | group_of_poster "" | xref | date_time_posted "2013-04-29 17:33:45" | xref | date_time_modified "2013-05-03 17:30:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "This is a chemical derivatization of the PLP imine with sodium borohydride to reduce imine bound through lysine epsilon amine group to chemical stable amine linkage" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1384] === UNIMOD:1384 Homocysteic_acid |
null .Term [UNIMOD:1384] [cols="2*"] |
| id | UNIMOD:1384 | name | Homocysteic_acid | def | "Methionine oxidation to homocysteic acid." [PMID:20169556, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1384] | xref | record_id "1384" | xref | delta_mono_mass "33.969094" | xref | delta_avge_mass "33.9716" | xref | delta_composition "H(-2) C(-1) O(3)" | xref | username_of_poster "mbern" | xref | group_of_poster "" | xref | date_time_posted "2013-05-16 20:08:11" | xref | date_time_modified "2013-05-31 15:57:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1385] === UNIMOD:1385 Hydroxamic_acid |
null .Term [UNIMOD:1385] [cols="2*"] |
| id | UNIMOD:1385 | name | Hydroxamic_acid | def | "ADP-ribosylation followed by conversion to hydroxamic acid via hydroxylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1385] | synonym | "Conversion of carboxylic acid to hydroxamic acid" [] | xref | record_id "1385" | xref | delta_mono_mass "15.010899" | xref | delta_avge_mass "15.0146" | xref | delta_composition "H N" | xref | username_of_poster "mbern" | xref | group_of_poster "" | xref | date_time_posted "2013-05-16 20:40:47" | xref | date_time_modified "2020-03-26 09:49:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_misc_notes "From exposure to hydroxylamine (used with TMT)" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_misc_notes "From exposure to hydroxylamine (used with TMT)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1387] === UNIMOD:1387 3-phosphoglyceryl |
null .Term [UNIMOD:1387] [cols="2*"] |
| id | UNIMOD:1387 | name | 3-phosphoglyceryl | def | "3-phosphoglyceryl." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/?term=23908237, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1387] | xref | record_id "1387" | xref | delta_mono_mass "167.982375" | xref | delta_avge_mass "168.042" | xref | delta_composition "H(5) C(3) O(6) P" | xref | username_of_poster "BThomas" | xref | group_of_poster "" | xref | date_time_posted "2013-08-05 10:54:22" | xref | date_time_modified "2013-11-01 16:34:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1388] === UNIMOD:1388 HN2_mustard |
null .Term [UNIMOD:1388] [cols="2*"] |
| id | UNIMOD:1388 | name | HN2_mustard | def | "Modification by hydroxylated mechloroethamine (HN-2)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1388] | xref | record_id "1388" | xref | delta_mono_mass "101.084064" | xref | delta_avge_mass "101.1469" | xref | delta_composition "H(11) C(5) N O" | xref | username_of_poster "vthompson" | xref | group_of_poster "" | xref | date_time_posted "2013-08-23 18:36:39" | xref | date_time_modified "2013-09-23 11:42:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1389] === UNIMOD:1389 HN3_mustard |
null .Term [UNIMOD:1389] [cols="2*"] |
| id | UNIMOD:1389 | name | HN3_mustard | def | "Modification by hydroxylated tris-(2-chloroethyl)amine (HN-3)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1389] | xref | record_id "1389" | xref | delta_mono_mass "131.094629" | xref | delta_avge_mass "131.1729" | xref | delta_composition "H(13) C(6) N O(2)" | xref | username_of_poster "vthompson" | xref | group_of_poster "" | xref | date_time_posted "2013-08-23 19:13:36" | xref | date_time_modified "2013-09-23 11:42:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1390] === UNIMOD:1390 Oxidation+NEM |
null .Term [UNIMOD:1390] [cols="2*"] |
| id | UNIMOD:1390 | name | Oxidation+NEM | def | "N-ethylmaleimide on cysteine sulfenic acid." [PMID:24103186, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1390] | xref | record_id "1390" | xref | delta_mono_mass "141.042593" | xref | delta_avge_mass "141.1247" | xref | delta_composition "H(7) C(6) N O(3)" | xref | username_of_poster "jheld" | xref | group_of_poster "" | xref | date_time_posted "2013-10-16 15:31:20" | xref | date_time_modified "2013-11-01 16:37:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1391] === UNIMOD:1391 NHS-fluorescein |
null .Term [UNIMOD:1391] [cols="2*"] |
| id | UNIMOD:1391 | name | NHS-fluorescein | def | "Fluorescein-hexanoate-NHS hydrolysis." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1391] | xref | record_id "1391" | xref | delta_mono_mass "471.131802" | xref | delta_avge_mass "471.4581" | xref | delta_composition "H(21) C(27) N O(7)" | xref | username_of_poster "cgadelha" | xref | group_of_poster "" | xref | date_time_posted "2013-10-18 12:14:19" | xref | date_time_modified "2013-11-01 16:37:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1392] === UNIMOD:1392 DiART6plex |
null .Term [UNIMOD:1392] [cols="2*"] |
| id | UNIMOD:1392 | name | DiART6plex | def | "Representative mass and accurate mass for 114." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1392] | comment | Different tags have the same nominal mass but slightly different exact masses. Use this modification for all tags for quantitation purposes. Monoisotopic masses of the fragment ions to be quantified are 114.12827, 115.12531, 116.14082, 117.13786, 118.14752, 119.14456. | synonym | "Isobaric labeling reagent from Omic Biosystems, Inc. AKA DiART6plex114" [] | xref | record_id "1392" | xref | delta_mono_mass "217.162932" | xref | delta_avge_mass "217.2527" | xref | delta_composition "H(20) C(7) 13C(4) N 15N O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2013-11-06 11:18:58" | xref | date_time_modified "2016-09-22 14:39:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "Y" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1393] === UNIMOD:1393 DiART6plex115 |
null .Term [UNIMOD:1393] [cols="2*"] |
| id | UNIMOD:1393 | name | DiART6plex115 | def | "Accurate mass for DiART6plex 115." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1393] | comment | Different tags have the same nominal mass but slightly different exact masses. | synonym | "Isobaric labeling reagent from Omic Biosystems, Inc." [] | xref | record_id "1393" | xref | delta_mono_mass "217.156612" | xref | delta_avge_mass "217.2535" | xref | delta_composition "H(20) C(8) 13C(3) 15N(2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2013-11-06 11:34:33" | xref | date_time_modified "2013-11-06 11:34:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "Y" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1394] === UNIMOD:1394 DiART6plex116/119 |
null .Term [UNIMOD:1394] [cols="2*"] |
| id | UNIMOD:1394 | name | DiART6plex116/119 | def | "Accurate mass for DiART6plex 116 and 119." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1394] | comment | Different tags have the same nominal mass but slightly different exact masses. | synonym | "Isobaric labeling reagent from Omic Biosystems, Inc." [] | xref | record_id "1394" | xref | delta_mono_mass "217.168776" | xref | delta_avge_mass "217.2797" | xref | delta_composition "H(18) 2H(2) C(9) 13C(2) N 15N O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2013-11-06 11:35:52" | xref | date_time_modified "2013-11-06 11:38:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "Y" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1395] === UNIMOD:1395 DiART6plex117 |
null .Term [UNIMOD:1395] [cols="2*"] |
| id | UNIMOD:1395 | name | DiART6plex117 | def | "Accurate mass for DiART6plex 117." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1395] | comment | Different tags have the same nominal mass but slightly different exact masses. | synonym | "Isobaric labeling reagent from Omic Biosystems, Inc." [] | xref | record_id "1395" | xref | delta_mono_mass "217.162456" | xref | delta_avge_mass "217.2805" | xref | delta_composition "H(18) 2H(2) C(10) 13C 15N(2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2013-11-06 11:40:01" | xref | date_time_modified "2013-11-06 11:40:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "Y" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1396] === UNIMOD:1396 DiART6plex118 |
null .Term [UNIMOD:1396] [cols="2*"] |
| id | UNIMOD:1396 | name | DiART6plex118 | def | "Accurate mass for DiART6plex 118." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1396] | comment | Different tags have the same nominal mass but slightly different exact masses. | synonym | "Isobaric labeling reagent from Omic Biosystems, Inc." [] | xref | record_id "1396" | xref | delta_mono_mass "217.175096" | xref | delta_avge_mass "217.279" | xref | delta_composition "H(18) 2H(2) C(8) 13C(3) N(2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2013-11-06 11:40:58" | xref | date_time_modified "2013-11-06 11:40:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "Y" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_4_misc_notes "Low abundance" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1397] === UNIMOD:1397 Iodoacetanilide |
null .Term [UNIMOD:1397] [cols="2*"] |
| id | UNIMOD:1397 | name | Iodoacetanilide | def | "Iodoacetanilide derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1397] | xref | record_id "1397" | xref | delta_mono_mass "133.052764" | xref | delta_avge_mass "133.1473" | xref | delta_composition "H(7) C(8) N O" | xref | username_of_poster "kcook123" | xref | group_of_poster "" | xref | date_time_posted "2013-12-10 04:26:07" | xref | date_time_modified "2014-03-01 17:35:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1398] === UNIMOD:1398 Iodoacetanilide:13C(6) |
null .Term [UNIMOD:1398] [cols="2*"] |
| id | UNIMOD:1398 | name | Iodoacetanilide:13C(6) | def | "13C labelled iodoacetanilide derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1398] | xref | record_id "1398" | xref | delta_mono_mass "139.072893" | xref | delta_avge_mass "139.1032" | xref | delta_composition "H(7) C(2) 13C(6) N O" | xref | username_of_poster "kcook123" | xref | group_of_poster "" | xref | date_time_posted "2013-12-10 04:31:00" | xref | date_time_modified "2014-03-01 17:36:23" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1399] === UNIMOD:1399 Dap-DSP |
null .Term [UNIMOD:1399] [cols="2*"] |
| id | UNIMOD:1399 | name | Dap-DSP | def | "Diaminopimelic acid-DSP monolinked." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011280_DTSSP_DSP_UG.pdf, URL:https\://www.ncbi.nlm.nih.gov/pubmed/?term=322714, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1399] | comment | Addition of gram negative peptidoglycan amino acid (DAP) plus monolinked DSP. | xref | record_id "1399" | xref | delta_mono_mass "364.076278" | xref | delta_avge_mass "364.4377" | xref | delta_composition "H(20) C(13) N(2) O(6) S(2)" | xref | username_of_poster "grigorios" | xref | group_of_poster "" | xref | date_time_posted "2014-02-20 11:23:24" | xref | date_time_modified "2017-09-19 11:06:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Non-standard residue" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Non-standard residue" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1400] === UNIMOD:1400 MurNAc |
null .Term [UNIMOD:1400] [cols="2*"] |
| id | UNIMOD:1400 | name | MurNAc | def | "N-Acetylmuramic acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1400] | comment | Gram negative peptidoglycan saccharide amide bonded to Alanine. | xref | record_id "1400" | xref | delta_mono_mass "275.100502" | xref | delta_avge_mass "275.2552" | xref | delta_composition "O(-1) NeuAc" | xref | username_of_poster "grigorios" | xref | group_of_poster "" | xref | date_time_posted "2014-02-20 12:47:46" | xref | date_time_modified "2015-05-01 13:37:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other glycosylation" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1402] === UNIMOD:1402 Label:2H(7)15N(4) |
null .Term [UNIMOD:1402] [cols="2*"] |
| id | UNIMOD:1402 | name | Label:2H(7)15N(4) | def | "Label:2H(7)15N(4)." [URL:http\://shop.isotope.com/productdetails.aspx?id=10032309&itemno=DNLM-7543-PK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1402] | comment | For SILAC experiments. | synonym | "Cambridge Isotopes DNLM-7543-PK" [] | xref | record_id "1402" | xref | delta_mono_mass "11.032077" | xref | delta_avge_mass "11.0168" | xref | delta_composition "H(-7) 2H(7) N(-4) 15N(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2014-04-16 12:16:45" | xref | date_time_modified "2014-04-16 12:16:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1403] === UNIMOD:1403 Label:2H(6)15N(1) |
null .Term [UNIMOD:1403] [cols="2*"] |
| id | UNIMOD:1403 | name | Label:2H(6)15N(1) | def | "Label:2H(6)15N(1)." [URL:http\://shop.isotope.com/productdetails.aspx?id=10032309&itemno=DNLM-7543-PK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1403] | comment | For SILAC experiments. | synonym | "Arg-Pro conversion of Label:2H(7)15N(4)" [] | xref | record_id "1403" | xref | delta_mono_mass "7.034695" | xref | delta_avge_mass "7.0304" | xref | delta_composition "H(-6) 2H(6) N(-1) 15N" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2014-04-16 12:19:06" | xref | date_time_modified "2014-04-16 12:19:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1405] === UNIMOD:1405 EEEDVIEVYQEQTGG |
null .Term [UNIMOD:1405] [cols="2*"] |
| id | UNIMOD:1405 | name | EEEDVIEVYQEQTGG | def | "Sumoylation by SUMO-1 after Cyanogen bromide (CNBr) cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1405] | xref | record_id "1405" | xref | delta_mono_mass "1705.73189" | xref | delta_avge_mass "1706.7153" | xref | delta_composition "H(107) C(72) N(17) O(31)" | xref | username_of_poster "vogelw" | xref | group_of_poster "" | xref | date_time_posted "2014-06-25 15:15:44" | xref | date_time_modified "2014-08-08 11:37:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1406] === UNIMOD:1406 EDEDTIDVFQQQTGG |
null .Term [UNIMOD:1406] [cols="2*"] |
| id | UNIMOD:1406 | name | EDEDTIDVFQQQTGG | def | "Sumoylation by SUMO-2/3 after Cyanogen bromide (CNBr) cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1406] | xref | record_id "1406" | xref | delta_mono_mass "1662.700924" | xref | delta_avge_mass "1663.6508" | xref | delta_composition "H(102) C(69) N(18) O(30)" | xref | username_of_poster "vogelw" | xref | group_of_poster "" | xref | date_time_posted "2014-06-25 15:19:11" | xref | date_time_modified "2014-08-08 11:37:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "The cleavage products of SUMO-2 and SUMO-3 are indistinguishable" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1408] === UNIMOD:1408 Hex(5)HexNAc(4)NeuAc(2) |
null .Term [UNIMOD:1408] [cols="2*"] |
| id | UNIMOD:1408 | name | Hex(5)HexNAc(4)NeuAc(2) | def | "Hex(5) HexNAc(4) NeuAc(2)." [URL:http\://www.unicarbkb.org/structure/1187, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1408] | xref | record_id "1408" | xref | delta_mono_mass "2204.772441" | xref | delta_avge_mass "2205.9822" | xref | delta_composition "Hex(5) HexNAc(4) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2014-07-31 13:51:41" | xref | date_time_modified "2015-07-03 17:01:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_2205_mono_mass "2204.772441" | xref | spec_1_neutral_loss_2205_avge_mass "2205.9822" | xref | spec_1_neutral_loss_2205_flag "false" | xref | spec_1_neutral_loss_2205_composition "Hex(5) HexNAc(4) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1409] === UNIMOD:1409 Hex(5)HexNAc(4)NeuAc(1) |
null .Term [UNIMOD:1409] [cols="2*"] |
| id | UNIMOD:1409 | name | Hex(5)HexNAc(4)NeuAc(1) | def | "Hex(5) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1409] | xref | record_id "1409" | xref | delta_mono_mass "1913.677025" | xref | delta_avge_mass "1914.7277" | xref | delta_composition "Hex(5) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2014-07-31 13:52:20" | xref | date_time_modified "2015-05-06 10:45:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1914_mono_mass "1913.677025" | xref | spec_1_neutral_loss_1914_avge_mass "1914.7277" | xref | spec_1_neutral_loss_1914_flag "false" | xref | spec_1_neutral_loss_1914_composition "Hex(5) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1410] === UNIMOD:1410 dHex(1)Hex(5)HexNAc(4)NeuAc(1) |
null .Term [UNIMOD:1410] [cols="2*"] |
| id | UNIMOD:1410 | name | dHex(1)Hex(5)HexNAc(4)NeuAc(1) | def | "DHex Hex(5) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1410] | xref | record_id "1410" | xref | delta_mono_mass "2059.734933" | xref | delta_avge_mass "2060.8689" | xref | delta_composition "dHex Hex(5) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2014-07-31 13:53:31" | xref | date_time_modified "2015-05-06 10:45:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_2060_mono_mass "2059.734933" | xref | spec_1_neutral_loss_2060_avge_mass "2060.8689" | xref | spec_1_neutral_loss_2060_flag "false" | xref | spec_1_neutral_loss_2060_composition "dHex Hex(5) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1411] === UNIMOD:1411 dHex(1)Hex(5)HexNAc(4)NeuAc(2) |
null .Term [UNIMOD:1411] [cols="2*"] |
| id | UNIMOD:1411 | name | dHex(1)Hex(5)HexNAc(4)NeuAc(2) | def | "DHex Hex(5) HexNAc(4) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1411] | xref | record_id "1411" | xref | delta_mono_mass "2350.83035" | xref | delta_avge_mass "2352.1234" | xref | delta_composition "dHex Hex(5) HexNAc(4) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2014-07-31 13:53:47" | xref | date_time_modified "2015-05-06 10:45:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_2351_mono_mass "2350.83035" | xref | spec_1_neutral_loss_2351_avge_mass "2352.1234" | xref | spec_1_neutral_loss_2351_flag "false" | xref | spec_1_neutral_loss_2351_composition "dHex Hex(5) HexNAc(4) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1412] === UNIMOD:1412 s-GlcNAc |
null .Term [UNIMOD:1412] [cols="2*"] |
| id | UNIMOD:1412 | name | s-GlcNAc | def | "O3S1HexNAc1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1412] | xref | record_id "1412" | xref | delta_mono_mass "283.036187" | xref | delta_avge_mass "283.2557" | xref | delta_composition "O(3) S HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2014-08-14 15:34:42" | xref | date_time_modified "2015-05-01 15:10:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_284_mono_mass "283.036187" | xref | spec_1_neutral_loss_284_avge_mass "283.2557" | xref | spec_1_neutral_loss_284_flag "false" | xref | spec_1_neutral_loss_284_composition "O(3) S HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_284_mono_mass "283.036187" | xref | spec_1_neutral_loss_284_avge_mass "283.2557" | xref | spec_1_neutral_loss_284_flag "false" | xref | spec_1_neutral_loss_284_composition "O(3) S HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1413] === UNIMOD:1413 PhosphoHex(2) |
null .Term [UNIMOD:1413] [cols="2*"] |
| id | UNIMOD:1413 | name | PhosphoHex(2) | def | "H1O3P1Hex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1413] | xref | record_id "1413" | xref | delta_mono_mass "404.071978" | xref | delta_avge_mass "404.2611" | xref | delta_composition "H O(3) P Hex(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2014-08-14 15:38:35" | xref | date_time_modified "2017-11-23 15:44:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_405_mono_mass "404.071978" | xref | spec_1_neutral_loss_405_avge_mass "404.2611" | xref | spec_1_neutral_loss_405_flag "false" | xref | spec_1_neutral_loss_405_composition "H O(3) P Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_405_mono_mass "404.071978" | xref | spec_1_neutral_loss_405_avge_mass "404.2611" | xref | spec_1_neutral_loss_405_flag "false" | xref | spec_1_neutral_loss_405_composition "H O(3) P Hex(2)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_misc_notes "Not reported for human proteins" | xref | spec_2_neutral_loss_405_mono_mass "404.071978" | xref | spec_2_neutral_loss_405_avge_mass "404.2611" | xref | spec_2_neutral_loss_405_flag "false" | xref | spec_2_neutral_loss_405_composition "H O(3) P Hex(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1414] === UNIMOD:1414 Trimethyl:13C(3)2H(9) |
null .Term [UNIMOD:1414] [cols="2*"] |
| id | UNIMOD:1414 | name | Trimethyl:13C(3)2H(9) | def | "3-fold methylation with fully labelled methyl groups." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1414] | xref | record_id "1414" | xref | delta_mono_mass "54.113505" | xref | delta_avge_mass "54.1132" | xref | delta_composition "H(-3) 2H(9) 13C(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2014-09-17 09:18:49" | xref | date_time_modified "2014-09-17 09:18:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1419] === UNIMOD:1419 15N-oxobutanoic |
null .Term [UNIMOD:1419] [cols="2*"] |
| id | UNIMOD:1419 | name | 15N-oxobutanoic | def | "Loss of ammonia (15N)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1419] | synonym | "pyruvic acid from N-term ser oxobutanoic acid from N term Thr" [] | xref | record_id "1419" | xref | delta_mono_mass "-18.023584" | xref | delta_avge_mass "-18.0239" | xref | delta_composition "H(-3) 15N(-1)" | xref | username_of_poster "fufezan" | xref | group_of_poster "" | xref | date_time_posted "2014-11-24 13:24:53" | xref | date_time_modified "2015-01-12 16:11:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Artefact" | xref | spec_1_misc_notes "Pyro-carbamidomethyl as a delta from Carbamidomethyl-Cys" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "T" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1420] === UNIMOD:1420 spermine |
null .Term [UNIMOD:1420] [cols="2*"] |
| id | UNIMOD:1420 | name | spermine | def | "Spermine adduct." [URL:http\://dx.doi.org/10.1007/s00726-014-1879-8, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1420] | xref | record_id "1420" | xref | delta_mono_mass "185.189198" | xref | delta_avge_mass "185.3097" | xref | delta_composition "H(23) C(10) N(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-01-12 16:07:00" | xref | date_time_modified "2015-01-12 16:07:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1421] === UNIMOD:1421 spermidine |
null .Term [UNIMOD:1421] [cols="2*"] |
| id | UNIMOD:1421 | name | spermidine | def | "Spermidine adduct." [URL:http\://dx.doi.org/10.1007/s00726-014-1879-8, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1421] | xref | record_id "1421" | xref | delta_mono_mass "128.131349" | xref | delta_avge_mass "128.2153" | xref | delta_composition "H(16) C(7) N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-01-12 16:08:04" | xref | date_time_modified "2015-01-12 16:08:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1423] === UNIMOD:1423 Biotin:Thermo-21330 |
null .Term [UNIMOD:1423] [cols="2*"] |
| id | UNIMOD:1423 | name | Biotin:Thermo-21330 | def | "Biotin_PEG4." [URL:http\://www.lifetechnologies.com/order/catalog/product/21330, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1423] | comment | Also available as 21329, 21362, 21363. | synonym | "NHS-PEG4-Biotin" [] | xref | record_id "1423" | xref | delta_mono_mass "473.219571" | xref | delta_avge_mass "473.5835" | xref | delta_composition "H(35) C(21) N(3) O(7) S" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2015-04-20 16:08:05" | xref | date_time_modified "2015-04-20 16:10:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1425] === UNIMOD:1425 Pentose |
null .Term [UNIMOD:1425] [cols="2*"] |
| id | UNIMOD:1425 | name | Pentose | def | "Pentose." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1425] | xref | record_id "1425" | xref | delta_mono_mass "132.042259" | xref | delta_avge_mass "132.1146" | xref | delta_composition "Pent" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-01 17:01:09" | xref | date_time_modified "2015-05-05 10:48:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_133_mono_mass "132.042259" | xref | spec_1_neutral_loss_133_avge_mass "132.1146" | xref | spec_1_neutral_loss_133_flag "false" | xref | spec_1_neutral_loss_133_composition "Pent" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_133_mono_mass "132.042259" | xref | spec_1_neutral_loss_133_avge_mass "132.1146" | xref | spec_1_neutral_loss_133_flag "false" | xref | spec_1_neutral_loss_133_composition "Pent" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1426] === UNIMOD:1426 Hex(1)Pent(1) |
null .Term [UNIMOD:1426] [cols="2*"] |
| id | UNIMOD:1426 | name | Hex(1)Pent(1) | def | "Hex Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1426] | xref | record_id "1426" | xref | delta_mono_mass "294.095082" | xref | delta_avge_mass "294.2552" | xref | delta_composition "Pent Hex" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-01 17:03:00" | xref | date_time_modified "2015-05-05 10:49:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_295_mono_mass "294.095082" | xref | spec_1_neutral_loss_295_avge_mass "294.2552" | xref | spec_1_neutral_loss_295_flag "false" | xref | spec_1_neutral_loss_295_composition "Pent Hex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_295_mono_mass "294.095082" | xref | spec_1_neutral_loss_295_avge_mass "294.2552" | xref | spec_1_neutral_loss_295_flag "false" | xref | spec_1_neutral_loss_295_composition "Pent Hex" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1427] === UNIMOD:1427 Hex(1)HexA(1) |
null .Term [UNIMOD:1427] [cols="2*"] |
| id | UNIMOD:1427 | name | Hex(1)HexA(1) | def | "Hex HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1427] | xref | record_id "1427" | xref | delta_mono_mass "338.084912" | xref | delta_avge_mass "338.2647" | xref | delta_composition "Hex HexA" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-01 17:05:51" | xref | date_time_modified "2015-05-05 10:49:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_339_mono_mass "338.084912" | xref | spec_1_neutral_loss_339_avge_mass "338.2647" | xref | spec_1_neutral_loss_339_flag "false" | xref | spec_1_neutral_loss_339_composition "Hex HexA" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_339_mono_mass "338.084912" | xref | spec_1_neutral_loss_339_avge_mass "338.2647" | xref | spec_1_neutral_loss_339_flag "false" | xref | spec_1_neutral_loss_339_composition "Hex HexA" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1428] === UNIMOD:1428 Hex(1)Pent(2) |
null .Term [UNIMOD:1428] [cols="2*"] |
| id | UNIMOD:1428 | name | Hex(1)Pent(2) | def | "Hex Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=2&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1428] | xref | record_id "1428" | xref | delta_mono_mass "426.137341" | xref | delta_avge_mass "426.3698" | xref | delta_composition "Pent(2) Hex" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 09:37:19" | xref | date_time_modified "2015-05-05 10:50:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_427_mono_mass "426.137341" | xref | spec_1_neutral_loss_427_avge_mass "426.3698" | xref | spec_1_neutral_loss_427_flag "false" | xref | spec_1_neutral_loss_427_composition "Pent(2) Hex" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_427_mono_mass "426.137341" | xref | spec_1_neutral_loss_427_avge_mass "426.3698" | xref | spec_1_neutral_loss_427_flag "false" | xref | spec_1_neutral_loss_427_composition "Pent(2) Hex" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1429] === UNIMOD:1429 Hex(1)HexNAc(1)Phos(1) |
null .Term [UNIMOD:1429] [cols="2*"] |
| id | UNIMOD:1429 | name | Hex(1)HexNAc(1)Phos(1) | def | "Hex HexNAc Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1429] | xref | record_id "1429" | xref | delta_mono_mass "445.098527" | xref | delta_avge_mass "445.313" | xref | delta_composition "H O(3) P Hex HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 09:40:49" | xref | date_time_modified "2015-05-06 12:07:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_446_mono_mass "445.098527" | xref | spec_1_neutral_loss_446_avge_mass "445.313" | xref | spec_1_neutral_loss_446_flag "false" | xref | spec_1_neutral_loss_446_composition "H O(3) P Hex HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_446_mono_mass "445.098527" | xref | spec_1_neutral_loss_446_avge_mass "445.313" | xref | spec_1_neutral_loss_446_flag "false" | xref | spec_1_neutral_loss_446_composition "H O(3) P Hex HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1430] === UNIMOD:1430 Hex(1)HexNAc(1)Sulf(1) |
null .Term [UNIMOD:1430] [cols="2*"] |
| id | UNIMOD:1430 | name | Hex(1)HexNAc(1)Sulf(1) | def | "Hex HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1430] | xref | record_id "1430" | xref | delta_mono_mass "445.089011" | xref | delta_avge_mass "445.3963" | xref | delta_composition "O(3) S Hex HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 09:41:48" | xref | date_time_modified "2015-05-06 12:07:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_446_mono_mass "445.089011" | xref | spec_1_neutral_loss_446_avge_mass "445.3963" | xref | spec_1_neutral_loss_446_flag "false" | xref | spec_1_neutral_loss_446_composition "O(3) S Hex HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_446_mono_mass "445.089011" | xref | spec_1_neutral_loss_446_avge_mass "445.3963" | xref | spec_1_neutral_loss_446_flag "false" | xref | spec_1_neutral_loss_446_composition "O(3) S Hex HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1431] === UNIMOD:1431 Hex(1)NeuAc(1) |
null .Term [UNIMOD:1431] [cols="2*"] |
| id | UNIMOD:1431 | name | Hex(1)NeuAc(1) | def | "Hex NeuAc ---OR--- HexNAc Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1431] | xref | record_id "1431" | xref | delta_mono_mass "453.14824" | xref | delta_avge_mass "453.3952" | xref | delta_composition "Hex NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 09:45:11" | xref | date_time_modified "2017-11-17 11:42:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_454_mono_mass "453.14824" | xref | spec_1_neutral_loss_454_avge_mass "453.3952" | xref | spec_1_neutral_loss_454_flag "false" | xref | spec_1_neutral_loss_454_composition "Hex NeuAc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_454_mono_mass "453.14824" | xref | spec_1_neutral_loss_454_avge_mass "453.3952" | xref | spec_1_neutral_loss_454_flag "false" | xref | spec_1_neutral_loss_454_composition "Hex NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1432] === UNIMOD:1432 Hex(1)NeuGc(1) |
null .Term [UNIMOD:1432] [cols="2*"] |
| id | UNIMOD:1432 | name | Hex(1)NeuGc(1) | def | "Hex NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1432] | xref | record_id "1432" | xref | delta_mono_mass "469.143155" | xref | delta_avge_mass "469.3946" | xref | delta_composition "Hex NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 09:45:57" | xref | date_time_modified "2015-05-05 10:51:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_470_mono_mass "469.143155" | xref | spec_1_neutral_loss_470_avge_mass "469.3946" | xref | spec_1_neutral_loss_470_flag "false" | xref | spec_1_neutral_loss_470_composition "Hex NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_470_mono_mass "469.143155" | xref | spec_1_neutral_loss_470_avge_mass "469.3946" | xref | spec_1_neutral_loss_470_flag "false" | xref | spec_1_neutral_loss_470_composition "Hex NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1433] === UNIMOD:1433 HexNAc(3) |
null .Term [UNIMOD:1433] [cols="2*"] |
| id | UNIMOD:1433 | name | HexNAc(3) | def | "HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1433] | xref | record_id "1433" | xref | delta_mono_mass "609.238118" | xref | delta_avge_mass "609.5776" | xref | delta_composition "HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 09:47:58" | xref | date_time_modified "2015-05-06 12:09:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_610_mono_mass "609.238118" | xref | spec_1_neutral_loss_610_avge_mass "609.5776" | xref | spec_1_neutral_loss_610_flag "false" | xref | spec_1_neutral_loss_610_composition "HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_610_mono_mass "609.238118" | xref | spec_1_neutral_loss_610_avge_mass "609.5776" | xref | spec_1_neutral_loss_610_flag "false" | xref | spec_1_neutral_loss_610_composition "HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1434] === UNIMOD:1434 HexNAc(1)NeuAc(1) |
null .Term [UNIMOD:1434] [cols="2*"] |
| id | UNIMOD:1434 | name | HexNAc(1)NeuAc(1) | def | "HexNAc NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1434] | xref | record_id "1434" | xref | delta_mono_mass "494.174789" | xref | delta_avge_mass "494.4471" | xref | delta_composition "HexNAc NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 09:53:18" | xref | date_time_modified "2015-05-05 10:52:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_495_mono_mass "494.174789" | xref | spec_1_neutral_loss_495_avge_mass "494.4471" | xref | spec_1_neutral_loss_495_flag "false" | xref | spec_1_neutral_loss_495_composition "HexNAc NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_495_mono_mass "494.174789" | xref | spec_1_neutral_loss_495_avge_mass "494.4471" | xref | spec_1_neutral_loss_495_flag "false" | xref | spec_1_neutral_loss_495_composition "HexNAc NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1435] === UNIMOD:1435 HexNAc(1)NeuGc(1) |
null .Term [UNIMOD:1435] [cols="2*"] |
| id | UNIMOD:1435 | name | HexNAc(1)NeuGc(1) | def | "HexNAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1435] | xref | record_id "1435" | xref | delta_mono_mass "510.169704" | xref | delta_avge_mass "510.4465" | xref | delta_composition "HexNAc NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 09:54:16" | xref | date_time_modified "2015-05-05 10:52:39" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_511_mono_mass "510.169704" | xref | spec_1_neutral_loss_511_avge_mass "510.4465" | xref | spec_1_neutral_loss_511_flag "false" | xref | spec_1_neutral_loss_511_composition "HexNAc NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_511_mono_mass "510.169704" | xref | spec_1_neutral_loss_511_avge_mass "510.4465" | xref | spec_1_neutral_loss_511_flag "false" | xref | spec_1_neutral_loss_511_composition "HexNAc NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1436] === UNIMOD:1436 Hex(1)HexNAc(1)dHex(1)Me(1) |
null .Term [UNIMOD:1436] [cols="2*"] |
| id | UNIMOD:1436 | name | Hex(1)HexNAc(1)dHex(1)Me(1) | def | "Hex HexNAc dHex Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&dhex=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1436] | xref | record_id "1436" | xref | delta_mono_mass "525.205755" | xref | delta_avge_mass "525.5009" | xref | delta_composition "Me dHex Hex HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 10:05:16" | xref | date_time_modified "2015-05-06 12:08:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_526_mono_mass "525.205755" | xref | spec_1_neutral_loss_526_avge_mass "525.5009" | xref | spec_1_neutral_loss_526_flag "false" | xref | spec_1_neutral_loss_526_composition "Me dHex Hex HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_526_mono_mass "525.205755" | xref | spec_1_neutral_loss_526_avge_mass "525.5009" | xref | spec_1_neutral_loss_526_flag "false" | xref | spec_1_neutral_loss_526_composition "Me dHex Hex HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1437] === UNIMOD:1437 Hex(1)HexNAc(1)dHex(1)Me(2) |
null .Term [UNIMOD:1437] [cols="2*"] |
| id | UNIMOD:1437 | name | Hex(1)HexNAc(1)dHex(1)Me(2) | def | "Hex HexNAc dHex Me(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=2&dhex=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1437] | xref | record_id "1437" | xref | delta_mono_mass "539.221405" | xref | delta_avge_mass "539.5275" | xref | delta_composition "Me(2) dHex Hex HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 10:06:28" | xref | date_time_modified "2015-05-06 12:08:43" | xref | approved "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_540_mono_mass "539.221405" | xref | spec_2_neutral_loss_540_avge_mass "539.5275" | xref | spec_2_neutral_loss_540_flag "false" | xref | spec_2_neutral_loss_540_composition "Me(2) dHex Hex HexNAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_540_mono_mass "539.221405" | xref | spec_2_neutral_loss_540_avge_mass "539.5275" | xref | spec_2_neutral_loss_540_flag "false" | xref | spec_2_neutral_loss_540_composition "Me(2) dHex Hex HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1438] === UNIMOD:1438 Hex(2)HexNAc(1) |
null .Term [UNIMOD:1438] [cols="2*"] |
| id | UNIMOD:1438 | name | Hex(2)HexNAc(1) | def | "Hex(2) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1438] | xref | record_id "1438" | xref | delta_mono_mass "527.18502" | xref | delta_avge_mass "527.4737" | xref | delta_composition "Hex(2) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 10:09:00" | xref | date_time_modified "2017-11-23 16:36:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_528_mono_mass "527.18502" | xref | spec_1_neutral_loss_528_avge_mass "527.4737" | xref | spec_1_neutral_loss_528_flag "false" | xref | spec_1_neutral_loss_528_composition "Hex(2) HexNAc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_528_mono_mass "527.18502" | xref | spec_1_neutral_loss_528_avge_mass "527.4737" | xref | spec_1_neutral_loss_528_flag "false" | xref | spec_1_neutral_loss_528_composition "Hex(2) HexNAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_528_mono_mass "527.18502" | xref | spec_2_neutral_loss_528_avge_mass "527.4737" | xref | spec_2_neutral_loss_528_flag "false" | xref | spec_2_neutral_loss_528_composition "Hex(2) HexNAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1439] === UNIMOD:1439 Hex(1)HexA(1)HexNAc(1) |
null .Term [UNIMOD:1439] [cols="2*"] |
| id | UNIMOD:1439 | name | Hex(1)HexA(1)HexNAc(1) | def | "Hex HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1439] | xref | record_id "1439" | xref | delta_mono_mass "541.164284" | xref | delta_avge_mass "541.4572" | xref | delta_composition "Hex HexA HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 10:10:30" | xref | date_time_modified "2015-05-05 10:55:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_542_mono_mass "541.164284" | xref | spec_1_neutral_loss_542_avge_mass "541.4572" | xref | spec_1_neutral_loss_542_flag "false" | xref | spec_1_neutral_loss_542_composition "Hex HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_542_mono_mass "541.164284" | xref | spec_1_neutral_loss_542_avge_mass "541.4572" | xref | spec_1_neutral_loss_542_flag "false" | xref | spec_1_neutral_loss_542_composition "Hex HexA HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1440] === UNIMOD:1440 Hex(2)HexNAc(1)Me(1) |
null .Term [UNIMOD:1440] [cols="2*"] |
| id | UNIMOD:1440 | name | Hex(2)HexNAc(1)Me(1) | def | "Hex(2) HexNAc Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1440] | xref | record_id "1440" | xref | delta_mono_mass "541.20067" | xref | delta_avge_mass "541.5003" | xref | delta_composition "Me Hex(2) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 10:12:19" | xref | date_time_modified "2015-05-06 12:08:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_542_mono_mass "541.20067" | xref | spec_1_neutral_loss_542_avge_mass "541.5003" | xref | spec_1_neutral_loss_542_flag "false" | xref | spec_1_neutral_loss_542_composition "Me Hex(2) HexNAc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_542_mono_mass "541.20067" | xref | spec_1_neutral_loss_542_avge_mass "541.5003" | xref | spec_1_neutral_loss_542_flag "false" | xref | spec_1_neutral_loss_542_composition "Me Hex(2) HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1441] === UNIMOD:1441 Hex(1)Pent(3) |
null .Term [UNIMOD:1441] [cols="2*"] |
| id | UNIMOD:1441 | name | Hex(1)Pent(3) | def | "Hex Pent(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=3&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1441] | xref | record_id "1441" | xref | delta_mono_mass "558.1796" | xref | delta_avge_mass "558.4845" | xref | delta_composition "Pent(3) Hex" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 10:14:37" | xref | date_time_modified "2017-11-23 16:39:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_559_mono_mass "558.1796" | xref | spec_1_neutral_loss_559_avge_mass "558.4845" | xref | spec_1_neutral_loss_559_flag "false" | xref | spec_1_neutral_loss_559_composition "Pent(3) Hex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_559_mono_mass "558.1796" | xref | spec_1_neutral_loss_559_avge_mass "558.4845" | xref | spec_1_neutral_loss_559_flag "false" | xref | spec_1_neutral_loss_559_composition "Pent(3) Hex" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1442] === UNIMOD:1442 Hex(1)NeuAc(1)Pent(1) |
null .Term [UNIMOD:1442] [cols="2*"] |
| id | UNIMOD:1442 | name | Hex(1)NeuAc(1)Pent(1) | def | "Hex NeuAc Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1442] | xref | record_id "1442" | xref | delta_mono_mass "585.190499" | xref | delta_avge_mass "585.5098" | xref | delta_composition "Pent Hex NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 10:59:44" | xref | date_time_modified "2015-05-05 10:59:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_586_mono_mass "585.190499" | xref | spec_1_neutral_loss_586_avge_mass "585.5098" | xref | spec_1_neutral_loss_586_flag "false" | xref | spec_1_neutral_loss_586_composition "Pent Hex NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_586_mono_mass "585.190499" | xref | spec_1_neutral_loss_586_avge_mass "585.5098" | xref | spec_1_neutral_loss_586_flag "false" | xref | spec_1_neutral_loss_586_composition "Pent Hex NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1443] === UNIMOD:1443 Hex(2)HexNAc(1)Sulf(1) |
null .Term [UNIMOD:1443] [cols="2*"] |
| id | UNIMOD:1443 | name | Hex(2)HexNAc(1)Sulf(1) | def | "Hex(2) HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1443] | xref | record_id "1443" | xref | delta_mono_mass "607.141834" | xref | delta_avge_mass "607.5369" | xref | delta_composition "O(3) S Hex(2) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 11:01:43" | xref | date_time_modified "2015-05-06 12:09:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_608_mono_mass "607.141834" | xref | spec_1_neutral_loss_608_avge_mass "607.5369" | xref | spec_1_neutral_loss_608_flag "false" | xref | spec_1_neutral_loss_608_composition "O(3) S Hex(2) HexNAc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_608_mono_mass "607.141834" | xref | spec_1_neutral_loss_608_avge_mass "607.5369" | xref | spec_1_neutral_loss_608_flag "false" | xref | spec_1_neutral_loss_608_composition "O(3) S Hex(2) HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1444] === UNIMOD:1444 Hex(2)NeuAc(1) |
null .Term [UNIMOD:1444] [cols="2*"] |
| id | UNIMOD:1444 | name | Hex(2)NeuAc(1) | def | "Hex(2) NeuAc ---OR--- Hex HexNAc Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1444] | xref | record_id "1444" | xref | delta_mono_mass "615.201064" | xref | delta_avge_mass "615.5358" | xref | delta_composition "Hex(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 11:04:03" | xref | date_time_modified "2017-11-17 11:43:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_616_mono_mass "615.201064" | xref | spec_1_neutral_loss_616_avge_mass "615.5358" | xref | spec_1_neutral_loss_616_flag "false" | xref | spec_1_neutral_loss_616_composition "Hex(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_616_mono_mass "615.201064" | xref | spec_1_neutral_loss_616_avge_mass "615.5358" | xref | spec_1_neutral_loss_616_flag "false" | xref | spec_1_neutral_loss_616_composition "Hex(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1445] === UNIMOD:1445 dHex(2)Hex(2) |
null .Term [UNIMOD:1445] [cols="2*"] |
| id | UNIMOD:1445 | name | dHex(2)Hex(2) | def | "Hex2 dHex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1445] | xref | record_id "1445" | xref | delta_mono_mass "616.221465" | xref | delta_avge_mass "616.5636" | xref | delta_composition "dHex(2) Hex(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 11:05:19" | xref | date_time_modified "2015-05-05 11:05:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_617_mono_mass "616.221465" | xref | spec_1_neutral_loss_617_avge_mass "616.5636" | xref | spec_1_neutral_loss_617_flag "false" | xref | spec_1_neutral_loss_617_composition "dHex(2) Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_617_mono_mass "616.221465" | xref | spec_1_neutral_loss_617_avge_mass "616.5636" | xref | spec_1_neutral_loss_617_flag "false" | xref | spec_1_neutral_loss_617_composition "dHex(2) Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1446] === UNIMOD:1446 dHex(1)Hex(2)HexA(1) |
null .Term [UNIMOD:1446] [cols="2*"] |
| id | UNIMOD:1446 | name | dHex(1)Hex(2)HexA(1) | def | "DHex Hex(2) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1446] | xref | record_id "1446" | xref | delta_mono_mass "646.195644" | xref | delta_avge_mass "646.5465" | xref | delta_composition "dHex Hex(2) HexA" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 11:06:47" | xref | date_time_modified "2015-05-05 11:06:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_647_mono_mass "646.195644" | xref | spec_1_neutral_loss_647_avge_mass "646.5465" | xref | spec_1_neutral_loss_647_flag "false" | xref | spec_1_neutral_loss_647_composition "dHex Hex(2) HexA" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_647_mono_mass "646.195644" | xref | spec_1_neutral_loss_647_avge_mass "646.5465" | xref | spec_1_neutral_loss_647_flag "false" | xref | spec_1_neutral_loss_647_composition "dHex Hex(2) HexA" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1447] === UNIMOD:1447 Hex(1)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1447] [cols="2*"] |
| id | UNIMOD:1447 | name | Hex(1)HexNAc(2)Sulf(1) | def | "Hex HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1447] | xref | record_id "1447" | xref | delta_mono_mass "648.168383" | xref | delta_avge_mass "648.5888" | xref | delta_composition "O(3) S Hex HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 11:09:57" | xref | date_time_modified "2015-05-06 12:09:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_649_mono_mass "648.168383" | xref | spec_1_neutral_loss_649_avge_mass "648.5888" | xref | spec_1_neutral_loss_649_flag "false" | xref | spec_1_neutral_loss_649_composition "O(3) S Hex HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_649_mono_mass "648.168383" | xref | spec_1_neutral_loss_649_avge_mass "648.5888" | xref | spec_1_neutral_loss_649_flag "false" | xref | spec_1_neutral_loss_649_composition "O(3) S Hex HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1448] === UNIMOD:1448 Hex(4) |
null .Term [UNIMOD:1448] [cols="2*"] |
| id | UNIMOD:1448 | name | Hex(4) | def | "Hex(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1448] | xref | record_id "1448" | xref | delta_mono_mass "648.211294" | xref | delta_avge_mass "648.5624" | xref | delta_composition "Hex(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 11:10:47" | xref | date_time_modified "2015-05-05 11:10:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_649_mono_mass "648.211294" | xref | spec_1_neutral_loss_649_avge_mass "648.5624" | xref | spec_1_neutral_loss_649_flag "false" | xref | spec_1_neutral_loss_649_composition "Hex(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_649_mono_mass "648.211294" | xref | spec_1_neutral_loss_649_avge_mass "648.5624" | xref | spec_1_neutral_loss_649_flag "false" | xref | spec_1_neutral_loss_649_composition "Hex(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1449] === UNIMOD:1449 dHex(1)Hex(2)HexNAc(2)Pent(1) |
null .Term [UNIMOD:1449] [cols="2*"] |
| id | UNIMOD:1449 | name | dHex(1)Hex(2)HexNAc(2)Pent(1) | def | "DHex Hex(2) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1449] | xref | record_id "1449" | xref | delta_mono_mass "1008.36456" | xref | delta_avge_mass "1008.9221" | xref | delta_composition "dHex(1) Hex(2) HexNAc(2) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1009_mono_mass "1008.36456" | xref | spec_1_neutral_loss_1009_avge_mass "1008.9221" | xref | spec_1_neutral_loss_1009_flag "false" | xref | spec_1_neutral_loss_1009_composition "dHex(1) Hex(2) HexNAc(2) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1450] === UNIMOD:1450 Hex(2)HexNAc(2)NeuAc(1) |
null .Term [UNIMOD:1450] [cols="2*"] |
| id | UNIMOD:1450 | name | Hex(2)HexNAc(2)NeuAc(1) | def | "Hex(2) HexNAc(2) NeuAc ---OR--- dHex Hex HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1450] | xref | record_id "1450" | xref | delta_mono_mass "1021.359809" | xref | delta_avge_mass "1021.9208" | xref | delta_composition "Hex(2) HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 11:53:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1022_mono_mass "1021.359809" | xref | spec_1_neutral_loss_1022_avge_mass "1021.9208" | xref | spec_1_neutral_loss_1022_flag "false" | xref | spec_1_neutral_loss_1022_composition "Hex(2) HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1022_mono_mass "1021.359809" | xref | spec_2_neutral_loss_1022_avge_mass "1021.9208" | xref | spec_2_neutral_loss_1022_flag "false" | xref | spec_2_neutral_loss_1022_composition "Hex(2) HexNAc(2) NeuAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1022_mono_mass "1021.359809" | xref | spec_2_neutral_loss_1022_avge_mass "1021.9208" | xref | spec_2_neutral_loss_1022_flag "false" | xref | spec_2_neutral_loss_1022_composition "Hex(2) HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1451] === UNIMOD:1451 Hex(3)HexNAc(2)Pent(1) |
null .Term [UNIMOD:1451] [cols="2*"] |
| id | UNIMOD:1451 | name | Hex(3)HexNAc(2)Pent(1) | def | "Hex(3) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1451] | xref | record_id "1451" | xref | delta_mono_mass "1024.359475" | xref | delta_avge_mass "1024.9215" | xref | delta_composition "Hex(3) HexNAc(2) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1025_mono_mass "1024.359475" | xref | spec_1_neutral_loss_1025_avge_mass "1024.9215" | xref | spec_1_neutral_loss_1025_flag "false" | xref | spec_1_neutral_loss_1025_composition "Hex(3) HexNAc(2) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1452] === UNIMOD:1452 Hex(4)HexNAc(2) |
null .Term [UNIMOD:1452] [cols="2*"] |
| id | UNIMOD:1452 | name | Hex(4)HexNAc(2) | def | "Hex(4) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1452] | xref | record_id "1452" | xref | delta_mono_mass "1054.370039" | xref | delta_avge_mass "1054.9474" | xref | delta_composition "Hex(4) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1055_mono_mass "1054.370039" | xref | spec_1_neutral_loss_1055_avge_mass "1054.9474" | xref | spec_1_neutral_loss_1055_flag "false" | xref | spec_1_neutral_loss_1055_composition "Hex(4) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1453] === UNIMOD:1453 dHex(1)Hex(4)HexNAc(1)Pent(1) |
null .Term [UNIMOD:1453] [cols="2*"] |
| id | UNIMOD:1453 | name | dHex(1)Hex(4)HexNAc(1)Pent(1) | def | "DHex Hex(4) HexNAc Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=1&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1453] | xref | record_id "1453" | xref | delta_mono_mass "1129.390834" | xref | delta_avge_mass "1130.0107" | xref | delta_composition "dHex(1) Hex(4) HexNAc(1) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1130_mono_mass "1129.390834" | xref | spec_1_neutral_loss_1130_avge_mass "1130.0107" | xref | spec_1_neutral_loss_1130_flag "false" | xref | spec_1_neutral_loss_1130_composition "dHex(1) Hex(4) HexNAc(1) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1454] === UNIMOD:1454 dHex(1)Hex(3)HexNAc(2)Pent(1) |
null .Term [UNIMOD:1454] [cols="2*"] |
| id | UNIMOD:1454 | name | dHex(1)Hex(3)HexNAc(2)Pent(1) | def | "DHex Hex(3) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1454] | xref | record_id "1454" | xref | delta_mono_mass "1170.417383" | xref | delta_avge_mass "1171.0627" | xref | delta_composition "dHex(1) Hex(3) HexNAc(2) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1171_mono_mass "1170.417383" | xref | spec_1_neutral_loss_1171_avge_mass "1171.0627" | xref | spec_1_neutral_loss_1171_flag "false" | xref | spec_1_neutral_loss_1171_composition "dHex(1) Hex(3) HexNAc(2) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1455] === UNIMOD:1455 Hex(3)HexNAc(2)NeuAc(1) |
null .Term [UNIMOD:1455] [cols="2*"] |
| id | UNIMOD:1455 | name | Hex(3)HexNAc(2)NeuAc(1) | def | "Hex(3) HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1455] | xref | record_id "1455" | xref | delta_mono_mass "1183.412632" | xref | delta_avge_mass "1184.0614" | xref | delta_composition "Hex(3) HexNAc(2) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1184_mono_mass "1183.412632" | xref | spec_1_neutral_loss_1184_avge_mass "1184.0614" | xref | spec_1_neutral_loss_1184_flag "false" | xref | spec_1_neutral_loss_1184_composition "Hex(3) HexNAc(2) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1456] === UNIMOD:1456 Hex(4)HexNAc(2)Pent(1) |
null .Term [UNIMOD:1456] [cols="2*"] |
| id | UNIMOD:1456 | name | Hex(4)HexNAc(2)Pent(1) | def | "Hex(4) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1456] | xref | record_id "1456" | xref | delta_mono_mass "1186.412298" | xref | delta_avge_mass "1187.0621" | xref | delta_composition "Hex(4) HexNAc(2) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1187_mono_mass "1186.412298" | xref | spec_1_neutral_loss_1187_avge_mass "1187.0621" | xref | spec_1_neutral_loss_1187_flag "false" | xref | spec_1_neutral_loss_1187_composition "Hex(4) HexNAc(2) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1457] === UNIMOD:1457 Hex(3)HexNAc(3)Pent(1) |
null .Term [UNIMOD:1457] [cols="2*"] |
| id | UNIMOD:1457 | name | Hex(3)HexNAc(3)Pent(1) | def | "Hex(3) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1457] | xref | record_id "1457" | xref | delta_mono_mass "1227.438847" | xref | delta_avge_mass "1228.114" | xref | delta_composition "Hex(3) HexNAc(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1228_mono_mass "1227.438847" | xref | spec_1_neutral_loss_1228_avge_mass "1228.114" | xref | spec_1_neutral_loss_1228_flag "false" | xref | spec_1_neutral_loss_1228_composition "Hex(3) HexNAc(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1458] === UNIMOD:1458 Hex(5)HexNAc(2)Phos(1) |
null .Term [UNIMOD:1458] [cols="2*"] |
| id | UNIMOD:1458 | name | Hex(5)HexNAc(2)Phos(1) | def | "Hex(5) HexNAc(2) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=5&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1458] | xref | record_id "1458" | xref | delta_mono_mass "1296.389194" | xref | delta_avge_mass "1297.0679" | xref | delta_composition "H O(3) P Hex(5) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:43:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1297_mono_mass "1296.389194" | xref | spec_1_neutral_loss_1297_avge_mass "1297.0679" | xref | spec_1_neutral_loss_1297_flag "false" | xref | spec_1_neutral_loss_1297_composition "H O(3) P Hex(5) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1459] === UNIMOD:1459 dHex(1)Hex(4)HexNAc(2)Pent(1) |
null .Term [UNIMOD:1459] [cols="2*"] |
| id | UNIMOD:1459 | name | dHex(1)Hex(4)HexNAc(2)Pent(1) | def | "DHex Hex(4) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1459] | xref | record_id "1459" | xref | delta_mono_mass "1332.470207" | xref | delta_avge_mass "1333.2033" | xref | delta_composition "dHex(1) Hex(4) HexNAc(2) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1333_mono_mass "1332.470207" | xref | spec_1_neutral_loss_1333_avge_mass "1333.2033" | xref | spec_1_neutral_loss_1333_flag "false" | xref | spec_1_neutral_loss_1333_composition "dHex(1) Hex(4) HexNAc(2) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1460] === UNIMOD:1460 Hex(7)HexNAc(1) |
null .Term [UNIMOD:1460] [cols="2*"] |
| id | UNIMOD:1460 | name | Hex(7)HexNAc(1) | def | "Hex(7) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=7&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1460] | xref | record_id "1460" | xref | delta_mono_mass "1337.449137" | xref | delta_avge_mass "1338.1767" | xref | delta_composition "Hex(7) HexNAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1338_mono_mass "1337.449137" | xref | spec_1_neutral_loss_1338_avge_mass "1338.1767" | xref | spec_1_neutral_loss_1338_flag "false" | xref | spec_1_neutral_loss_1338_composition "Hex(7) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1461] === UNIMOD:1461 Hex(4)HexNAc(2)NeuAc(1) |
null .Term [UNIMOD:1461] [cols="2*"] |
| id | UNIMOD:1461 | name | Hex(4)HexNAc(2)NeuAc(1) | def | "Hex(4) HexNAc(2) NeuAc ---OR--- Hex(3) HexNAc(2) dHex NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1461] | xref | record_id "1461" | xref | delta_mono_mass "1345.465456" | xref | delta_avge_mass "1346.202" | xref | delta_composition "Hex(4) HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 13:30:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1346_mono_mass "1345.465456" | xref | spec_1_neutral_loss_1346_avge_mass "1346.202" | xref | spec_1_neutral_loss_1346_flag "false" | xref | spec_1_neutral_loss_1346_composition "Hex(4) HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1346_mono_mass "1345.465456" | xref | spec_2_neutral_loss_1346_avge_mass "1346.202" | xref | spec_2_neutral_loss_1346_flag "false" | xref | spec_2_neutral_loss_1346_composition "Hex(4) HexNAc(2) NeuAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1346_mono_mass "1345.465456" | xref | spec_2_neutral_loss_1346_avge_mass "1346.202" | xref | spec_2_neutral_loss_1346_flag "false" | xref | spec_2_neutral_loss_1346_composition "Hex(4) HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1462] === UNIMOD:1462 dHex(1)Hex(5)HexNAc(2) |
null .Term [UNIMOD:1462] [cols="2*"] |
| id | UNIMOD:1462 | name | dHex(1)Hex(5)HexNAc(2) | def | "DHex Hex(5) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1462] | xref | record_id "1462" | xref | delta_mono_mass "1362.480772" | xref | delta_avge_mass "1363.2292" | xref | delta_composition "dHex(1) Hex(5) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1363_mono_mass "1362.480772" | xref | spec_1_neutral_loss_1363_avge_mass "1363.2292" | xref | spec_1_neutral_loss_1363_flag "false" | xref | spec_1_neutral_loss_1363_composition "dHex(1) Hex(5) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1463] === UNIMOD:1463 dHex(1)Hex(3)HexNAc(3)Pent(1) |
null .Term [UNIMOD:1463] [cols="2*"] |
| id | UNIMOD:1463 | name | dHex(1)Hex(3)HexNAc(3)Pent(1) | def | "DHex Hex(3) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1463] | xref | record_id "1463" | xref | delta_mono_mass "1373.496756" | xref | delta_avge_mass "1374.2552" | xref | delta_composition "dHex(1) Hex(3) HexNAc(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1374_mono_mass "1373.496756" | xref | spec_1_neutral_loss_1374_avge_mass "1374.2552" | xref | spec_1_neutral_loss_1374_flag "false" | xref | spec_1_neutral_loss_1374_composition "dHex(1) Hex(3) HexNAc(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1464] === UNIMOD:1464 Hex(3)HexNAc(4)Sulf(1) |
null .Term [UNIMOD:1464] [cols="2*"] |
| id | UNIMOD:1464 | name | Hex(3)HexNAc(4)Sulf(1) | def | "Hex(3) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1464] | xref | record_id "1464" | xref | delta_mono_mass "1378.432776" | xref | delta_avge_mass "1379.2551" | xref | delta_composition "O(3) S Hex(3) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:33:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1379_mono_mass "1378.432776" | xref | spec_1_neutral_loss_1379_avge_mass "1379.2551" | xref | spec_1_neutral_loss_1379_flag "false" | xref | spec_1_neutral_loss_1379_composition "O(3) S Hex(3) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1465] === UNIMOD:1465 Hex(6)HexNAc(2) |
null .Term [UNIMOD:1465] [cols="2*"] |
| id | UNIMOD:1465 | name | Hex(6)HexNAc(2) | def | "Hex(6) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1465] | xref | record_id "1465" | xref | delta_mono_mass "1378.475686" | xref | delta_avge_mass "1379.2286" | xref | delta_composition "Hex(6) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1379_mono_mass "1378.475686" | xref | spec_1_neutral_loss_1379_avge_mass "1379.2286" | xref | spec_1_neutral_loss_1379_flag "false" | xref | spec_1_neutral_loss_1379_composition "Hex(6) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1466] === UNIMOD:1466 Hex(4)HexNAc(3)Pent(1) |
null .Term [UNIMOD:1466] [cols="2*"] |
| id | UNIMOD:1466 | name | Hex(4)HexNAc(3)Pent(1) | def | "Hex(4) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1466] | xref | record_id "1466" | xref | delta_mono_mass "1389.491671" | xref | delta_avge_mass "1390.2546" | xref | delta_composition "Hex(4) HexNAc(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1390_mono_mass "1389.491671" | xref | spec_1_neutral_loss_1390_avge_mass "1390.2546" | xref | spec_1_neutral_loss_1390_flag "false" | xref | spec_1_neutral_loss_1390_composition "Hex(4) HexNAc(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1467] === UNIMOD:1467 dHex(1)Hex(4)HexNAc(3) |
null .Term [UNIMOD:1467] [cols="2*"] |
| id | UNIMOD:1467 | name | dHex(1)Hex(4)HexNAc(3) | def | "DHex Hex(4) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1467] | xref | record_id "1467" | xref | delta_mono_mass "1403.507321" | xref | delta_avge_mass "1404.2812" | xref | delta_composition "dHex(1) Hex(4) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1404_mono_mass "1403.507321" | xref | spec_1_neutral_loss_1404_avge_mass "1404.2812" | xref | spec_1_neutral_loss_1404_flag "false" | xref | spec_1_neutral_loss_1404_composition "dHex(1) Hex(4) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1468] === UNIMOD:1468 Hex(5)HexNAc(3) |
null .Term [UNIMOD:1468] [cols="2*"] |
| id | UNIMOD:1468 | name | Hex(5)HexNAc(3) | def | "Hex(5) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1468] | xref | record_id "1468" | xref | delta_mono_mass "1419.502235" | xref | delta_avge_mass "1420.2806" | xref | delta_composition "Hex(5) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1420_mono_mass "1419.502235" | xref | spec_1_neutral_loss_1420_avge_mass "1420.2806" | xref | spec_1_neutral_loss_1420_flag "false" | xref | spec_1_neutral_loss_1420_composition "Hex(5) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1469] === UNIMOD:1469 Hex(3)HexNAc(4)Pent(1) |
null .Term [UNIMOD:1469] [cols="2*"] |
| id | UNIMOD:1469 | name | Hex(3)HexNAc(4)Pent(1) | def | "Hex(3) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1469] | xref | record_id "1469" | xref | delta_mono_mass "1430.51822" | xref | delta_avge_mass "1431.3065" | xref | delta_composition "Hex(3) HexNAc(4) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1431_mono_mass "1430.51822" | xref | spec_1_neutral_loss_1431_avge_mass "1431.3065" | xref | spec_1_neutral_loss_1431_flag "false" | xref | spec_1_neutral_loss_1431_composition "Hex(3) HexNAc(4) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1470] === UNIMOD:1470 Hex(6)HexNAc(2)Phos(1) |
null .Term [UNIMOD:1470] [cols="2*"] |
| id | UNIMOD:1470 | name | Hex(6)HexNAc(2)Phos(1) | def | "Hex(6) HexNAc(2) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=6&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1470] | xref | record_id "1470" | xref | delta_mono_mass "1458.442017" | xref | delta_avge_mass "1459.2085" | xref | delta_composition "H O(3) P Hex(6) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:43:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1459_mono_mass "1458.442017" | xref | spec_1_neutral_loss_1459_avge_mass "1459.2085" | xref | spec_1_neutral_loss_1459_flag "false" | xref | spec_1_neutral_loss_1459_composition "H O(3) P Hex(6) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1471] === UNIMOD:1471 dHex(1)Hex(4)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1471] [cols="2*"] |
| id | UNIMOD:1471 | name | dHex(1)Hex(4)HexNAc(3)Sulf(1) | def | "DHex Hex(4) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1471] | xref | record_id "1471" | xref | delta_mono_mass "1483.464135" | xref | delta_avge_mass "1484.3444" | xref | delta_composition "O(3) S dHex Hex(4) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:34:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1484_mono_mass "1483.464135" | xref | spec_1_neutral_loss_1484_avge_mass "1484.3444" | xref | spec_1_neutral_loss_1484_flag "false" | xref | spec_1_neutral_loss_1484_composition "O(3) S dHex Hex(4) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1472] === UNIMOD:1472 dHex(1)Hex(5)HexNAc(2)Pent(1) |
null .Term [UNIMOD:1472] [cols="2*"] |
| id | UNIMOD:1472 | name | dHex(1)Hex(5)HexNAc(2)Pent(1) | def | "DHex Hex(5) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1472] | xref | record_id "1472" | xref | delta_mono_mass "1494.52303" | xref | delta_avge_mass "1495.3439" | xref | delta_composition "dHex(1) Hex(5) HexNAc(2) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1495_mono_mass "1494.52303" | xref | spec_1_neutral_loss_1495_avge_mass "1495.3439" | xref | spec_1_neutral_loss_1495_flag "false" | xref | spec_1_neutral_loss_1495_composition "dHex(1) Hex(5) HexNAc(2) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1473] === UNIMOD:1473 Hex(8)HexNAc(1) |
null .Term [UNIMOD:1473] [cols="2*"] |
| id | UNIMOD:1473 | name | Hex(8)HexNAc(1) | def | "Hex(8) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=8&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1473] | xref | record_id "1473" | xref | delta_mono_mass "1499.501961" | xref | delta_avge_mass "1500.3173" | xref | delta_composition "Hex(8) HexNAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1500_mono_mass "1499.501961" | xref | spec_1_neutral_loss_1500_avge_mass "1500.3173" | xref | spec_1_neutral_loss_1500_flag "false" | xref | spec_1_neutral_loss_1500_composition "Hex(8) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1474] === UNIMOD:1474 dHex(1)Hex(3)HexNAc(3)Pent(2) |
null .Term [UNIMOD:1474] [cols="2*"] |
| id | UNIMOD:1474 | name | dHex(1)Hex(3)HexNAc(3)Pent(2) | def | "DHex Hex(3) HexNAc(3) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=3&pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1474] | xref | record_id "1474" | xref | delta_mono_mass "1505.539015" | xref | delta_avge_mass "1506.3698" | xref | delta_composition "dHex(1) Hex(3) HexNAc(3) Pent(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1506_mono_mass "1505.539015" | xref | spec_1_neutral_loss_1506_avge_mass "1506.3698" | xref | spec_1_neutral_loss_1506_flag "false" | xref | spec_1_neutral_loss_1506_composition "dHex(1) Hex(3) HexNAc(3) Pent(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1475] === UNIMOD:1475 dHex(2)Hex(3)HexNAc(3)Pent(1) |
null .Term [UNIMOD:1475] [cols="2*"] |
| id | UNIMOD:1475 | name | dHex(2)Hex(3)HexNAc(3)Pent(1) | def | "DHex(2) Hex(3) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1475] | xref | record_id "1475" | xref | delta_mono_mass "1519.554665" | xref | delta_avge_mass "1520.3964" | xref | delta_composition "dHex(2) Hex(3) HexNAc(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1520_mono_mass "1519.554665" | xref | spec_1_neutral_loss_1520_avge_mass "1520.3964" | xref | spec_1_neutral_loss_1520_flag "false" | xref | spec_1_neutral_loss_1520_composition "dHex(2) Hex(3) HexNAc(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1476] === UNIMOD:1476 dHex(1)Hex(3)HexNAc(4)Sulf(1) |
null .Term [UNIMOD:1476] [cols="2*"] |
| id | UNIMOD:1476 | name | dHex(1)Hex(3)HexNAc(4)Sulf(1) | def | "DHex Hex(3) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1476] | xref | record_id "1476" | xref | delta_mono_mass "1524.490684" | xref | delta_avge_mass "1525.3963" | xref | delta_composition "O(3) S dHex Hex(3) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:34:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1525_mono_mass "1524.490684" | xref | spec_1_neutral_loss_1525_avge_mass "1525.3963" | xref | spec_1_neutral_loss_1525_flag "false" | xref | spec_1_neutral_loss_1525_composition "O(3) S dHex Hex(3) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1477] === UNIMOD:1477 dHex(1)Hex(6)HexNAc(2) |
null .Term [UNIMOD:1477] [cols="2*"] |
| id | UNIMOD:1477 | name | dHex(1)Hex(6)HexNAc(2) | def | "DHex Hex(6) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=6&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1477] | xref | record_id "1477" | xref | delta_mono_mass "1524.533595" | xref | delta_avge_mass "1525.3698" | xref | delta_composition "dHex(1) Hex(6) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1525_mono_mass "1524.533595" | xref | spec_1_neutral_loss_1525_avge_mass "1525.3698" | xref | spec_1_neutral_loss_1525_flag "false" | xref | spec_1_neutral_loss_1525_composition "dHex(1) Hex(6) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1478] === UNIMOD:1478 dHex(1)Hex(4)HexNAc(3)Pent(1) |
null .Term [UNIMOD:1478] [cols="2*"] |
| id | UNIMOD:1478 | name | dHex(1)Hex(4)HexNAc(3)Pent(1) | def | "DHex Hex(4) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1478] | xref | record_id "1478" | xref | delta_mono_mass "1535.549579" | xref | delta_avge_mass "1536.3958" | xref | delta_composition "dHex(1) Hex(4) HexNAc(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1536_mono_mass "1535.549579" | xref | spec_1_neutral_loss_1536_avge_mass "1536.3958" | xref | spec_1_neutral_loss_1536_flag "false" | xref | spec_1_neutral_loss_1536_composition "dHex(1) Hex(4) HexNAc(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1479] === UNIMOD:1479 Hex(4)HexNAc(4)Sulf(1) |
null .Term [UNIMOD:1479] [cols="2*"] |
| id | UNIMOD:1479 | name | Hex(4)HexNAc(4)Sulf(1) | def | "Hex(4) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1479] | xref | record_id "1479" | xref | delta_mono_mass "1540.485599" | xref | delta_avge_mass "1541.3957" | xref | delta_composition "O(3) S Hex(4) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:34:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1541_mono_mass "1540.485599" | xref | spec_1_neutral_loss_1541_avge_mass "1541.3957" | xref | spec_1_neutral_loss_1541_flag "false" | xref | spec_1_neutral_loss_1541_composition "O(3) S Hex(4) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1480] === UNIMOD:1480 Hex(7)HexNAc(2) |
null .Term [UNIMOD:1480] [cols="2*"] |
| id | UNIMOD:1480 | name | Hex(7)HexNAc(2) | def | "Hex(7) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=7&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1480] | xref | record_id "1480" | xref | delta_mono_mass "1540.52851" | xref | delta_avge_mass "1541.3692" | xref | delta_composition "Hex(7) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1541_mono_mass "1540.52851" | xref | spec_1_neutral_loss_1541_avge_mass "1541.3692" | xref | spec_1_neutral_loss_1541_flag "false" | xref | spec_1_neutral_loss_1541_composition "Hex(7) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1481] === UNIMOD:1481 dHex(2)Hex(4)HexNAc(3) |
null .Term [UNIMOD:1481] [cols="2*"] |
| id | UNIMOD:1481 | name | dHex(2)Hex(4)HexNAc(3) | def | "DHex(2) Hex(4) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1481] | xref | record_id "1481" | xref | delta_mono_mass "1549.56523" | xref | delta_avge_mass "1550.4224" | xref | delta_composition "dHex(2) Hex(4) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1550_mono_mass "1549.56523" | xref | spec_1_neutral_loss_1550_avge_mass "1550.4224" | xref | spec_1_neutral_loss_1550_flag "false" | xref | spec_1_neutral_loss_1550_composition "dHex(2) Hex(4) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1482] === UNIMOD:1482 Hex(5)HexNAc(3)Pent(1) |
null .Term [UNIMOD:1482] [cols="2*"] |
| id | UNIMOD:1482 | name | Hex(5)HexNAc(3)Pent(1) | def | "Hex(5) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1482] | xref | record_id "1482" | xref | delta_mono_mass "1551.544494" | xref | delta_avge_mass "1552.3952" | xref | delta_composition "Hex(5) HexNAc(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1552_mono_mass "1551.544494" | xref | spec_1_neutral_loss_1552_avge_mass "1552.3952" | xref | spec_1_neutral_loss_1552_flag "false" | xref | spec_1_neutral_loss_1552_composition "Hex(5) HexNAc(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1483] === UNIMOD:1483 Hex(4)HexNAc(3)NeuGc(1) |
null .Term [UNIMOD:1483] [cols="2*"] |
| id | UNIMOD:1483 | name | Hex(4)HexNAc(3)NeuGc(1) | def | "Hex(4) HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1483] | xref | record_id "1483" | xref | delta_mono_mass "1564.539743" | xref | delta_avge_mass "1565.3939" | xref | delta_composition "Hex(4) HexNAc(3) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1565_mono_mass "1564.539743" | xref | spec_1_neutral_loss_1565_avge_mass "1565.3939" | xref | spec_1_neutral_loss_1565_flag "false" | xref | spec_1_neutral_loss_1565_composition "Hex(4) HexNAc(3) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1484] === UNIMOD:1484 dHex(1)Hex(5)HexNAc(3) |
null .Term [UNIMOD:1484] [cols="2*"] |
| id | UNIMOD:1484 | name | dHex(1)Hex(5)HexNAc(3) | def | "DHex Hex(5) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1484] | xref | record_id "1484" | xref | delta_mono_mass "1565.560144" | xref | delta_avge_mass "1566.4218" | xref | delta_composition "dHex(1) Hex(5) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1566_mono_mass "1565.560144" | xref | spec_1_neutral_loss_1566_avge_mass "1566.4218" | xref | spec_1_neutral_loss_1566_flag "false" | xref | spec_1_neutral_loss_1566_composition "dHex(1) Hex(5) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1485] === UNIMOD:1485 dHex(1)Hex(3)HexNAc(4)Pent(1) |
null .Term [UNIMOD:1485] [cols="2*"] |
| id | UNIMOD:1485 | name | dHex(1)Hex(3)HexNAc(4)Pent(1) | def | "DHex Hex(3) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1485] | xref | record_id "1485" | xref | delta_mono_mass "1576.576129" | xref | delta_avge_mass "1577.4477" | xref | delta_composition "dHex(1) Hex(3) HexNAc(4) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1577_mono_mass "1576.576129" | xref | spec_1_neutral_loss_1577_avge_mass "1577.4477" | xref | spec_1_neutral_loss_1577_flag "false" | xref | spec_1_neutral_loss_1577_composition "dHex(1) Hex(3) HexNAc(4) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1486] === UNIMOD:1486 Hex(3)HexNAc(5)Sulf(1) |
null .Term [UNIMOD:1486] [cols="2*"] |
| id | UNIMOD:1486 | name | Hex(3)HexNAc(5)Sulf(1) | def | "Hex(3) HexNAc(5) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1486] | xref | record_id "1486" | xref | delta_mono_mass "1581.512148" | xref | delta_avge_mass "1582.4476" | xref | delta_composition "O(3) S Hex(3) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:35:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1582_mono_mass "1581.512148" | xref | spec_1_neutral_loss_1582_avge_mass "1582.4476" | xref | spec_1_neutral_loss_1582_flag "false" | xref | spec_1_neutral_loss_1582_composition "O(3) S Hex(3) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1487] === UNIMOD:1487 Hex(6)HexNAc(3) |
null .Term [UNIMOD:1487] [cols="2*"] |
| id | UNIMOD:1487 | name | Hex(6)HexNAc(3) | def | "Hex(6) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1487] | xref | record_id "1487" | xref | delta_mono_mass "1581.555059" | xref | delta_avge_mass "1582.4212" | xref | delta_composition "Hex(6) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1582_mono_mass "1581.555059" | xref | spec_1_neutral_loss_1582_avge_mass "1582.4212" | xref | spec_1_neutral_loss_1582_flag "false" | xref | spec_1_neutral_loss_1582_composition "Hex(6) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1488] === UNIMOD:1488 Hex(3)HexNAc(4)NeuAc(1) |
null .Term [UNIMOD:1488] [cols="2*"] |
| id | UNIMOD:1488 | name | Hex(3)HexNAc(4)NeuAc(1) | def | "Hex(3) HexNAc(4) NeuAc ---OR--- Hex(2) HexNAc(4) dHex NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1488] | xref | record_id "1488" | xref | delta_mono_mass "1589.571378" | xref | delta_avge_mass "1590.4465" | xref | delta_composition "Hex(3) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 16:47:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1590_mono_mass "1589.571378" | xref | spec_1_neutral_loss_1590_avge_mass "1590.4465" | xref | spec_1_neutral_loss_1590_flag "false" | xref | spec_1_neutral_loss_1590_composition "Hex(3) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1489] === UNIMOD:1489 Hex(4)HexNAc(4)Pent(1) |
null .Term [UNIMOD:1489] [cols="2*"] |
| id | UNIMOD:1489 | name | Hex(4)HexNAc(4)Pent(1) | def | "Hex(4) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1489] | xref | record_id "1489" | xref | delta_mono_mass "1592.571043" | xref | delta_avge_mass "1593.4471" | xref | delta_composition "Hex(4) HexNAc(4) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1593_mono_mass "1592.571043" | xref | spec_1_neutral_loss_1593_avge_mass "1593.4471" | xref | spec_1_neutral_loss_1593_flag "false" | xref | spec_1_neutral_loss_1593_composition "Hex(4) HexNAc(4) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1490] === UNIMOD:1490 Hex(7)HexNAc(2)Phos(1) |
null .Term [UNIMOD:1490] [cols="2*"] |
| id | UNIMOD:1490 | name | Hex(7)HexNAc(2)Phos(1) | def | "Hex(7) HexNAc(2) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=7&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1490] | xref | record_id "1490" | xref | delta_mono_mass "1620.494841" | xref | delta_avge_mass "1621.3491" | xref | delta_composition "H O(3) P Hex(7) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:43:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1621_mono_mass "1620.494841" | xref | spec_1_neutral_loss_1621_avge_mass "1621.3491" | xref | spec_1_neutral_loss_1621_flag "false" | xref | spec_1_neutral_loss_1621_composition "H O(3) P Hex(7) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1491] === UNIMOD:1491 Hex(4)HexNAc(4)Me(2)Pent(1) |
null .Term [UNIMOD:1491] [cols="2*"] |
| id | UNIMOD:1491 | name | Hex(4)HexNAc(4)Me(2)Pent(1) | def | "Hex(4) HexNAc(4) Me(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&methyl=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1491] | xref | record_id "1491" | xref | delta_mono_mass "1620.602343" | xref | delta_avge_mass "1621.5003" | xref | delta_composition "Hex(4) HexNAc(4) Me(2) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1621_mono_mass "1620.602343" | xref | spec_1_neutral_loss_1621_avge_mass "1621.5003" | xref | spec_1_neutral_loss_1621_flag "false" | xref | spec_1_neutral_loss_1621_composition "Hex(4) HexNAc(4) Me(2) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1492] === UNIMOD:1492 dHex(1)Hex(3)HexNAc(3)Pent(3) |
null .Term [UNIMOD:1492] [cols="2*"] |
| id | UNIMOD:1492 | name | dHex(1)Hex(3)HexNAc(3)Pent(3) | def | "DHex Hex(3) HexNAc(3) Pent(3) ---OR--- Hex(4) HexNAc(2) dHex(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=3&dhex=1&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1492] | xref | record_id "1492" | xref | delta_mono_mass "1637.581274" | xref | delta_avge_mass "1638.4844" | xref | delta_composition "Pent(3) dHex Hex(3) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-22 10:46:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1638_mono_mass "1637.581274" | xref | spec_1_neutral_loss_1638_avge_mass "1638.4844" | xref | spec_1_neutral_loss_1638_flag "false" | xref | spec_1_neutral_loss_1638_composition "Pent(3) dHex Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1493] === UNIMOD:1493 dHex(1)Hex(5)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1493] [cols="2*"] |
| id | UNIMOD:1493 | name | dHex(1)Hex(5)HexNAc(3)Sulf(1) | def | "DHex Hex(5) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1493] | xref | record_id "1493" | xref | delta_mono_mass "1645.516959" | xref | delta_avge_mass "1646.485" | xref | delta_composition "O(3) S dHex Hex(5) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:35:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1646_mono_mass "1645.516959" | xref | spec_1_neutral_loss_1646_avge_mass "1646.485" | xref | spec_1_neutral_loss_1646_flag "false" | xref | spec_1_neutral_loss_1646_composition "O(3) S dHex Hex(5) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1494] === UNIMOD:1494 dHex(2)Hex(3)HexNAc(3)Pent(2) |
null .Term [UNIMOD:1494] [cols="2*"] |
| id | UNIMOD:1494 | name | dHex(2)Hex(3)HexNAc(3)Pent(2) | def | "DHex(2) Hex(3) HexNAc(3) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1494] | xref | record_id "1494" | xref | delta_mono_mass "1651.596924" | xref | delta_avge_mass "1652.511" | xref | delta_composition "dHex(2) Hex(3) HexNAc(3) Pent(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1652_mono_mass "1651.596924" | xref | spec_1_neutral_loss_1652_avge_mass "1652.511" | xref | spec_1_neutral_loss_1652_flag "false" | xref | spec_1_neutral_loss_1652_composition "dHex(2) Hex(3) HexNAc(3) Pent(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1495] === UNIMOD:1495 Hex(6)HexNAc(3)Phos(1) |
null .Term [UNIMOD:1495] [cols="2*"] |
| id | UNIMOD:1495 | name | Hex(6)HexNAc(3)Phos(1) | def | "Hex(6) HexNAc(3) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=6&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1495] | xref | record_id "1495" | xref | delta_mono_mass "1661.52139" | xref | delta_avge_mass "1662.4011" | xref | delta_composition "H O(3) P Hex(6) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:43:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1662_mono_mass "1661.52139" | xref | spec_1_neutral_loss_1662_avge_mass "1662.4011" | xref | spec_1_neutral_loss_1662_flag "false" | xref | spec_1_neutral_loss_1662_composition "H O(3) P Hex(6) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1496] === UNIMOD:1496 Hex(4)HexNAc(5) |
null .Term [UNIMOD:1496] [cols="2*"] |
| id | UNIMOD:1496 | name | Hex(4)HexNAc(5) | def | "Hex(4) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1496] | xref | record_id "1496" | xref | delta_mono_mass "1663.608157" | xref | delta_avge_mass "1664.525" | xref | delta_composition "Hex(4) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1664_mono_mass "1663.608157" | xref | spec_1_neutral_loss_1664_avge_mass "1664.525" | xref | spec_1_neutral_loss_1664_flag "false" | xref | spec_1_neutral_loss_1664_composition "Hex(4) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1497] === UNIMOD:1497 dHex(3)Hex(3)HexNAc(3)Pent(1) |
null .Term [UNIMOD:1497] [cols="2*"] |
| id | UNIMOD:1497 | name | dHex(3)Hex(3)HexNAc(3)Pent(1) | def | "DHex(3) Hex(3) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1497] | xref | record_id "1497" | xref | delta_mono_mass "1665.612574" | xref | delta_avge_mass "1666.5376" | xref | delta_composition "dHex(3) Hex(3) HexNAc(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1666_mono_mass "1665.612574" | xref | spec_1_neutral_loss_1666_avge_mass "1666.5376" | xref | spec_1_neutral_loss_1666_flag "false" | xref | spec_1_neutral_loss_1666_composition "dHex(3) Hex(3) HexNAc(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1498] === UNIMOD:1498 dHex(2)Hex(4)HexNAc(3)Pent(1) |
null .Term [UNIMOD:1498] [cols="2*"] |
| id | UNIMOD:1498 | name | dHex(2)Hex(4)HexNAc(3)Pent(1) | def | "DHex(2) Hex(4) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1498] | xref | record_id "1498" | xref | delta_mono_mass "1681.607488" | xref | delta_avge_mass "1682.537" | xref | delta_composition "dHex(2) Hex(4) HexNAc(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1682_mono_mass "1681.607488" | xref | spec_1_neutral_loss_1682_avge_mass "1682.537" | xref | spec_1_neutral_loss_1682_flag "false" | xref | spec_1_neutral_loss_1682_composition "dHex(2) Hex(4) HexNAc(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1499] === UNIMOD:1499 dHex(1)Hex(4)HexNAc(4)Sulf(1) |
null .Term [UNIMOD:1499] [cols="2*"] |
| id | UNIMOD:1499 | name | dHex(1)Hex(4)HexNAc(4)Sulf(1) | def | "DHex Hex(4) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1499] | xref | record_id "1499" | xref | delta_mono_mass "1686.543508" | xref | delta_avge_mass "1687.5369" | xref | delta_composition "O(3) S dHex Hex(4) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:35:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1687_mono_mass "1686.543508" | xref | spec_1_neutral_loss_1687_avge_mass "1687.5369" | xref | spec_1_neutral_loss_1687_flag "false" | xref | spec_1_neutral_loss_1687_composition "O(3) S dHex Hex(4) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1500] === UNIMOD:1500 dHex(1)Hex(7)HexNAc(2) |
null .Term [UNIMOD:1500] [cols="2*"] |
| id | UNIMOD:1500 | name | dHex(1)Hex(7)HexNAc(2) | def | "DHex Hex(7) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=7&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1500] | xref | record_id "1500" | xref | delta_mono_mass "1686.586419" | xref | delta_avge_mass "1687.5104" | xref | delta_composition "dHex(1) Hex(7) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1687_mono_mass "1686.586419" | xref | spec_1_neutral_loss_1687_avge_mass "1687.5104" | xref | spec_1_neutral_loss_1687_flag "false" | xref | spec_1_neutral_loss_1687_composition "dHex(1) Hex(7) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1501] === UNIMOD:1501 dHex(1)Hex(4)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1501] [cols="2*"] |
| id | UNIMOD:1501 | name | dHex(1)Hex(4)HexNAc(3)NeuAc(1) | def | "DHex Hex(4) HexNAc(3) NeuAc ---OR--- dHex(2) Hex(3) HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1501] | xref | record_id "1501" | xref | delta_mono_mass "1694.602737" | xref | delta_avge_mass "1695.5357" | xref | delta_composition "dHex Hex(4) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-22 10:54:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1695_mono_mass "1694.602737" | xref | spec_1_neutral_loss_1695_avge_mass "1695.5357" | xref | spec_1_neutral_loss_1695_flag "false" | xref | spec_1_neutral_loss_1695_composition "dHex Hex(4) HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1695_mono_mass "1694.602737" | xref | spec_2_neutral_loss_1695_avge_mass "1695.5357" | xref | spec_2_neutral_loss_1695_flag "false" | xref | spec_2_neutral_loss_1695_composition "dHex Hex(4) HexNAc(3) NeuAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1695_mono_mass "1694.602737" | xref | spec_2_neutral_loss_1695_avge_mass "1695.5357" | xref | spec_2_neutral_loss_1695_flag "false" | xref | spec_2_neutral_loss_1695_composition "dHex Hex(4) HexNAc(3) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1502] === UNIMOD:1502 Hex(7)HexNAc(2)Phos(2) |
null .Term [UNIMOD:1502] [cols="2*"] |
| id | UNIMOD:1502 | name | Hex(7)HexNAc(2)Phos(2) | def | "Hex(7) HexNAc(2) Phos(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=2&hex=7&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1502] | xref | record_id "1502" | xref | delta_mono_mass "1700.461172" | xref | delta_avge_mass "1701.329" | xref | delta_composition "H(2) O(6) P(2) Hex(7) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:44:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1701_mono_mass "1700.461172" | xref | spec_1_neutral_loss_1701_avge_mass "1701.329" | xref | spec_1_neutral_loss_1701_flag "false" | xref | spec_1_neutral_loss_1701_composition "H(2) O(6) P(2) Hex(7) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1503] === UNIMOD:1503 Hex(5)HexNAc(4)Sulf(1) |
null .Term [UNIMOD:1503] [cols="2*"] |
| id | UNIMOD:1503 | name | Hex(5)HexNAc(4)Sulf(1) | def | "Hex(5) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1503] | xref | record_id "1503" | xref | delta_mono_mass "1702.538423" | xref | delta_avge_mass "1703.5363" | xref | delta_composition "O(3) S Hex(5) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:35:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1703_mono_mass "1702.538423" | xref | spec_1_neutral_loss_1703_avge_mass "1703.5363" | xref | spec_1_neutral_loss_1703_flag "false" | xref | spec_1_neutral_loss_1703_composition "O(3) S Hex(5) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1504] === UNIMOD:1504 Hex(8)HexNAc(2) |
null .Term [UNIMOD:1504] [cols="2*"] |
| id | UNIMOD:1504 | name | Hex(8)HexNAc(2) | def | "Hex(8) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=8&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1504] | xref | record_id "1504" | xref | delta_mono_mass "1702.581333" | xref | delta_avge_mass "1703.5098" | xref | delta_composition "Hex(8) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1703_mono_mass "1702.581333" | xref | spec_1_neutral_loss_1703_avge_mass "1703.5098" | xref | spec_1_neutral_loss_1703_flag "false" | xref | spec_1_neutral_loss_1703_composition "Hex(8) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1505] === UNIMOD:1505 dHex(1)Hex(3)HexNAc(4)Pent(2) |
null .Term [UNIMOD:1505] [cols="2*"] |
| id | UNIMOD:1505 | name | dHex(1)Hex(3)HexNAc(4)Pent(2) | def | "DHex Hex(3) HexNAc(4) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1505] | xref | record_id "1505" | xref | delta_mono_mass "1708.618387" | xref | delta_avge_mass "1709.5623" | xref | delta_composition "dHex(1) Hex(3) HexNAc(4) Pent(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1709_mono_mass "1708.618387" | xref | spec_1_neutral_loss_1709_avge_mass "1709.5623" | xref | spec_1_neutral_loss_1709_flag "false" | xref | spec_1_neutral_loss_1709_composition "dHex(1) Hex(3) HexNAc(4) Pent(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1506] === UNIMOD:1506 dHex(1)Hex(4)HexNAc(3)NeuGc(1) |
null .Term [UNIMOD:1506] [cols="2*"] |
| id | UNIMOD:1506 | name | dHex(1)Hex(4)HexNAc(3)NeuGc(1) | def | "DHex Hex(4) HexNAc(3) NeuGc ---OR--- Hex(5) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1506] | xref | record_id "1506" | xref | delta_mono_mass "1710.597652" | xref | delta_avge_mass "1711.5351" | xref | delta_composition "dHex Hex(4) HexNAc(3) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-22 11:04:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1711_mono_mass "1710.597652" | xref | spec_1_neutral_loss_1711_avge_mass "1711.5351" | xref | spec_1_neutral_loss_1711_flag "false" | xref | spec_1_neutral_loss_1711_composition "dHex Hex(4) HexNAc(3) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1507] === UNIMOD:1507 dHex(2)Hex(3)HexNAc(4)Pent(1) |
null .Term [UNIMOD:1507] [cols="2*"] |
| id | UNIMOD:1507 | name | dHex(2)Hex(3)HexNAc(4)Pent(1) | def | "DHex(2) Hex(3) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1507] | xref | record_id "1507" | xref | delta_mono_mass "1722.634037" | xref | delta_avge_mass "1723.5889" | xref | delta_composition "dHex(2) Hex(3) HexNAc(4) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1723_mono_mass "1722.634037" | xref | spec_1_neutral_loss_1723_avge_mass "1723.5889" | xref | spec_1_neutral_loss_1723_flag "false" | xref | spec_1_neutral_loss_1723_composition "dHex(2) Hex(3) HexNAc(4) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1508] === UNIMOD:1508 dHex(1)Hex(3)HexNAc(5)Sulf(1) |
null .Term [UNIMOD:1508] [cols="2*"] |
| id | UNIMOD:1508 | name | dHex(1)Hex(3)HexNAc(5)Sulf(1) | def | "DHex Hex(3) HexNAc(5) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1508] | xref | record_id "1508" | xref | delta_mono_mass "1727.570057" | xref | delta_avge_mass "1728.5888" | xref | delta_composition "O(3) S dHex Hex(3) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:36:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1728_mono_mass "1727.570057" | xref | spec_1_neutral_loss_1728_avge_mass "1728.5888" | xref | spec_1_neutral_loss_1728_flag "false" | xref | spec_1_neutral_loss_1728_composition "O(3) S dHex Hex(3) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1509] === UNIMOD:1509 dHex(1)Hex(6)HexNAc(3) |
null .Term [UNIMOD:1509] [cols="2*"] |
| id | UNIMOD:1509 | name | dHex(1)Hex(6)HexNAc(3) | def | "DHex Hex(6) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=6&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1509] | xref | record_id "1509" | xref | delta_mono_mass "1727.612968" | xref | delta_avge_mass "1728.5624" | xref | delta_composition "dHex(1) Hex(6) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1728_mono_mass "1727.612968" | xref | spec_1_neutral_loss_1728_avge_mass "1728.5624" | xref | spec_1_neutral_loss_1728_flag "false" | xref | spec_1_neutral_loss_1728_composition "dHex(1) Hex(6) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1510] === UNIMOD:1510 dHex(1)Hex(3)HexNAc(4)NeuAc(1) |
null .Term [UNIMOD:1510] [cols="2*"] |
| id | UNIMOD:1510 | name | dHex(1)Hex(3)HexNAc(4)NeuAc(1) | def | "DHex Hex(3) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1510] | xref | record_id "1510" | xref | delta_mono_mass "1735.629286" | xref | delta_avge_mass "1736.5877" | xref | delta_composition "dHex(1) Hex(3) HexNAc(4) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1736_mono_mass "1735.629286" | xref | spec_1_neutral_loss_1736_avge_mass "1736.5877" | xref | spec_1_neutral_loss_1736_flag "false" | xref | spec_1_neutral_loss_1736_composition "dHex(1) Hex(3) HexNAc(4) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1511] === UNIMOD:1511 dHex(3)Hex(3)HexNAc(4) |
null .Term [UNIMOD:1511] [cols="2*"] |
| id | UNIMOD:1511 | name | dHex(3)Hex(3)HexNAc(4) | def | "DHex(3) Hex(3) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1511] | xref | record_id "1511" | xref | delta_mono_mass "1736.649688" | xref | delta_avge_mass "1737.6155" | xref | delta_composition "dHex(3) Hex(3) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1737_mono_mass "1736.649688" | xref | spec_1_neutral_loss_1737_avge_mass "1737.6155" | xref | spec_1_neutral_loss_1737_flag "false" | xref | spec_1_neutral_loss_1737_composition "dHex(3) Hex(3) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1512] === UNIMOD:1512 dHex(1)Hex(4)HexNAc(4)Pent(1) |
null .Term [UNIMOD:1512] [cols="2*"] |
| id | UNIMOD:1512 | name | dHex(1)Hex(4)HexNAc(4)Pent(1) | def | "DHex Hex(4) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1512] | xref | record_id "1512" | xref | delta_mono_mass "1738.628952" | xref | delta_avge_mass "1739.5883" | xref | delta_composition "dHex(1) Hex(4) HexNAc(4) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1739_mono_mass "1738.628952" | xref | spec_1_neutral_loss_1739_avge_mass "1739.5883" | xref | spec_1_neutral_loss_1739_flag "false" | xref | spec_1_neutral_loss_1739_composition "dHex(1) Hex(4) HexNAc(4) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1513] === UNIMOD:1513 Hex(4)HexNAc(5)Sulf(1) |
null .Term [UNIMOD:1513] [cols="2*"] |
| id | UNIMOD:1513 | name | Hex(4)HexNAc(5)Sulf(1) | def | "Hex(4) HexNAc(5) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1513] | xref | record_id "1513" | xref | delta_mono_mass "1743.564972" | xref | delta_avge_mass "1744.5882" | xref | delta_composition "O(3) S Hex(4) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:36:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1744_mono_mass "1743.564972" | xref | spec_1_neutral_loss_1744_avge_mass "1744.5882" | xref | spec_1_neutral_loss_1744_flag "false" | xref | spec_1_neutral_loss_1744_composition "O(3) S Hex(4) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1514] === UNIMOD:1514 Hex(7)HexNAc(3) |
null .Term [UNIMOD:1514] [cols="2*"] |
| id | UNIMOD:1514 | name | Hex(7)HexNAc(3) | def | "Hex(7) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1514] | xref | record_id "1514" | xref | delta_mono_mass "1743.607882" | xref | delta_avge_mass "1744.5618" | xref | delta_composition "Hex(7) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1744_mono_mass "1743.607882" | xref | spec_1_neutral_loss_1744_avge_mass "1744.5618" | xref | spec_1_neutral_loss_1744_flag "false" | xref | spec_1_neutral_loss_1744_composition "Hex(7) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1515] === UNIMOD:1515 dHex(1)Hex(4)HexNAc(3)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1515] [cols="2*"] |
| id | UNIMOD:1515 | name | dHex(1)Hex(4)HexNAc(3)NeuAc(1)Sulf(1) | def | "DHex Hex(4) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1515] | xref | record_id "1515" | xref | delta_mono_mass "1774.559552" | xref | delta_avge_mass "1775.5989" | xref | delta_composition "O(3) S dHex Hex(4) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:36:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1775_mono_mass "1774.559552" | xref | spec_1_neutral_loss_1775_avge_mass "1775.5989" | xref | spec_1_neutral_loss_1775_flag "false" | xref | spec_1_neutral_loss_1775_composition "O(3) S dHex Hex(4) HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1516] === UNIMOD:1516 Hex(5)HexNAc(4)Me(2)Pent(1) |
null .Term [UNIMOD:1516] [cols="2*"] |
| id | UNIMOD:1516 | name | Hex(5)HexNAc(4)Me(2)Pent(1) | def | "Hex(5) HexNAc(4) Me(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&methyl=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1516] | xref | record_id "1516" | xref | delta_mono_mass "1782.655167" | xref | delta_avge_mass "1783.6409" | xref | delta_composition "Hex(5) HexNAc(4) Me(2) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1783_mono_mass "1782.655167" | xref | spec_1_neutral_loss_1783_avge_mass "1783.6409" | xref | spec_1_neutral_loss_1783_flag "false" | xref | spec_1_neutral_loss_1783_composition "Hex(5) HexNAc(4) Me(2) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1517] === UNIMOD:1517 Hex(3)HexNAc(6)Sulf(1) |
null .Term [UNIMOD:1517] [cols="2*"] |
| id | UNIMOD:1517 | name | Hex(3)HexNAc(6)Sulf(1) | def | "Hex(3) HexNAc(6) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1517] | xref | record_id "1517" | xref | delta_mono_mass "1784.591521" | xref | delta_avge_mass "1785.6401" | xref | delta_composition "O(3) S Hex(3) HexNAc(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:36:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1785_mono_mass "1784.591521" | xref | spec_1_neutral_loss_1785_avge_mass "1785.6401" | xref | spec_1_neutral_loss_1785_flag "false" | xref | spec_1_neutral_loss_1785_composition "O(3) S Hex(3) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1518] === UNIMOD:1518 dHex(1)Hex(6)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1518] [cols="2*"] |
| id | UNIMOD:1518 | name | dHex(1)Hex(6)HexNAc(3)Sulf(1) | def | "DHex Hex(6) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=6&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1518] | xref | record_id "1518" | xref | delta_mono_mass "1807.569782" | xref | delta_avge_mass "1808.6256" | xref | delta_composition "O(3) S dHex Hex(6) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:36:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1808_mono_mass "1807.569782" | xref | spec_1_neutral_loss_1808_avge_mass "1808.6256" | xref | spec_1_neutral_loss_1808_flag "false" | xref | spec_1_neutral_loss_1808_composition "O(3) S dHex Hex(6) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1519] === UNIMOD:1519 dHex(1)Hex(4)HexNAc(5) |
null .Term [UNIMOD:1519] [cols="2*"] |
| id | UNIMOD:1519 | name | dHex(1)Hex(4)HexNAc(5) | def | "DHex Hex(4) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1519] | xref | record_id "1519" | xref | delta_mono_mass "1809.666066" | xref | delta_avge_mass "1810.6662" | xref | delta_composition "dHex(1) Hex(4) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1810_mono_mass "1809.666066" | xref | spec_1_neutral_loss_1810_avge_mass "1810.6662" | xref | spec_1_neutral_loss_1810_flag "false" | xref | spec_1_neutral_loss_1810_composition "dHex(1) Hex(4) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1520] === UNIMOD:1520 dHex(1)Hex(5)HexA(1)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1520] [cols="2*"] |
| id | UNIMOD:1520 | name | dHex(1)Hex(5)HexA(1)HexNAc(3)Sulf(1) | def | "DHex Hex(5) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1520] | xref | record_id "1520" | xref | delta_mono_mass "1821.549047" | xref | delta_avge_mass "1822.6091" | xref | delta_composition "O(3) S dHex Hex(5) HexA HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:37:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1822_mono_mass "1821.549047" | xref | spec_1_neutral_loss_1822_avge_mass "1822.6091" | xref | spec_1_neutral_loss_1822_flag "false" | xref | spec_1_neutral_loss_1822_composition "O(3) S dHex Hex(5) HexA HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1521] === UNIMOD:1521 Hex(7)HexNAc(3)Phos(1) |
null .Term [UNIMOD:1521] [cols="2*"] |
| id | UNIMOD:1521 | name | Hex(7)HexNAc(3)Phos(1) | def | "Hex(7) HexNAc(3) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1521] | xref | record_id "1521" | xref | delta_mono_mass "1823.574213" | xref | delta_avge_mass "1824.5417" | xref | delta_composition "H O(3) P Hex(7) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:44:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1824_mono_mass "1823.574213" | xref | spec_1_neutral_loss_1824_avge_mass "1824.5417" | xref | spec_1_neutral_loss_1824_flag "false" | xref | spec_1_neutral_loss_1824_composition "H O(3) P Hex(7) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1522] === UNIMOD:1522 Hex(6)HexNAc(4)Me(3) |
null .Term [UNIMOD:1522] [cols="2*"] |
| id | UNIMOD:1522 | name | Hex(6)HexNAc(4)Me(3) | def | "Hex(6) HexNAc(4) Me(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=4&methyl=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1522] | xref | record_id "1522" | xref | delta_mono_mass "1826.681382" | xref | delta_avge_mass "1827.6934" | xref | delta_composition "Hex(6) HexNAc(4) Me(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1827_mono_mass "1826.681382" | xref | spec_1_neutral_loss_1827_avge_mass "1827.6934" | xref | spec_1_neutral_loss_1827_flag "false" | xref | spec_1_neutral_loss_1827_composition "Hex(6) HexNAc(4) Me(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1523] === UNIMOD:1523 dHex(2)Hex(4)HexNAc(4)Sulf(1) |
null .Term [UNIMOD:1523] [cols="2*"] |
| id | UNIMOD:1523 | name | dHex(2)Hex(4)HexNAc(4)Sulf(1) | def | "DHex(2) Hex(4) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1523] | xref | record_id "1523" | xref | delta_mono_mass "1832.601417" | xref | delta_avge_mass "1833.6781" | xref | delta_composition "O(3) S dHex(2) Hex(4) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:37:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1833_mono_mass "1832.601417" | xref | spec_1_neutral_loss_1833_avge_mass "1833.6781" | xref | spec_1_neutral_loss_1833_flag "false" | xref | spec_1_neutral_loss_1833_composition "O(3) S dHex(2) Hex(4) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1524] === UNIMOD:1524 Hex(4)HexNAc(3)NeuAc(2) |
null .Term [UNIMOD:1524] [cols="2*"] |
| id | UNIMOD:1524 | name | Hex(4)HexNAc(3)NeuAc(2) | def | "Hex(4) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1524] | xref | record_id "1524" | xref | delta_mono_mass "1839.640245" | xref | delta_avge_mass "1840.6491" | xref | delta_composition "Hex(4) HexNAc(3) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1840_mono_mass "1839.640245" | xref | spec_1_neutral_loss_1840_avge_mass "1840.6491" | xref | spec_1_neutral_loss_1840_flag "false" | xref | spec_1_neutral_loss_1840_composition "Hex(4) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1525] === UNIMOD:1525 dHex(1)Hex(3)HexNAc(4)Pent(3) |
null .Term [UNIMOD:1525] [cols="2*"] |
| id | UNIMOD:1525 | name | dHex(1)Hex(3)HexNAc(4)Pent(3) | def | "DHex Hex(3) HexNAc(4) Pent(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&pent=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1525] | xref | record_id "1525" | xref | delta_mono_mass "1840.660646" | xref | delta_avge_mass "1841.6769" | xref | delta_composition "dHex(1) Hex(3) HexNAc(4) Pent(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1841_mono_mass "1840.660646" | xref | spec_1_neutral_loss_1841_avge_mass "1841.6769" | xref | spec_1_neutral_loss_1841_flag "false" | xref | spec_1_neutral_loss_1841_composition "dHex(1) Hex(3) HexNAc(4) Pent(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1526] === UNIMOD:1526 dHex(2)Hex(5)HexNAc(3)Pent(1) |
null .Term [UNIMOD:1526] [cols="2*"] |
| id | UNIMOD:1526 | name | dHex(2)Hex(5)HexNAc(3)Pent(1) | def | "DHex(2) Hex(5) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=5&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1526] | xref | record_id "1526" | xref | delta_mono_mass "1843.660312" | xref | delta_avge_mass "1844.6776" | xref | delta_composition "dHex(2) Hex(5) HexNAc(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1844_mono_mass "1843.660312" | xref | spec_1_neutral_loss_1844_avge_mass "1844.6776" | xref | spec_1_neutral_loss_1844_flag "false" | xref | spec_1_neutral_loss_1844_composition "dHex(2) Hex(5) HexNAc(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1527] === UNIMOD:1527 dHex(1)Hex(5)HexNAc(4)Sulf(1) |
null .Term [UNIMOD:1527] [cols="2*"] |
| id | UNIMOD:1527 | name | dHex(1)Hex(5)HexNAc(4)Sulf(1) | def | "DHex Hex(5) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1527] | xref | record_id "1527" | xref | delta_mono_mass "1848.596331" | xref | delta_avge_mass "1849.6775" | xref | delta_composition "O(3) S dHex Hex(5) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:37:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1849_mono_mass "1848.596331" | xref | spec_1_neutral_loss_1849_avge_mass "1849.6775" | xref | spec_1_neutral_loss_1849_flag "false" | xref | spec_1_neutral_loss_1849_composition "O(3) S dHex Hex(5) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1528] === UNIMOD:1528 dHex(2)Hex(3)HexNAc(4)Pent(2) |
null .Term [UNIMOD:1528] [cols="2*"] |
| id | UNIMOD:1528 | name | dHex(2)Hex(3)HexNAc(4)Pent(2) | def | "DHex(2) Hex(3) HexNAc(4) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=4&pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1528] | xref | record_id "1528" | xref | delta_mono_mass "1854.676296" | xref | delta_avge_mass "1855.7035" | xref | delta_composition "dHex(2) Hex(3) HexNAc(4) Pent(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1855_mono_mass "1854.676296" | xref | spec_1_neutral_loss_1855_avge_mass "1855.7035" | xref | spec_1_neutral_loss_1855_flag "false" | xref | spec_1_neutral_loss_1855_composition "dHex(2) Hex(3) HexNAc(4) Pent(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1529] === UNIMOD:1529 dHex(1)Hex(5)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1529] [cols="2*"] |
| id | UNIMOD:1529 | name | dHex(1)Hex(5)HexNAc(3)NeuAc(1) | def | "DHex Hex(5) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1529] | xref | record_id "1529" | xref | delta_mono_mass "1856.655561" | xref | delta_avge_mass "1857.6763" | xref | delta_composition "dHex(1) Hex(5) HexNAc(3) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1857_mono_mass "1856.655561" | xref | spec_1_neutral_loss_1857_avge_mass "1857.6763" | xref | spec_1_neutral_loss_1857_flag "false" | xref | spec_1_neutral_loss_1857_composition "dHex(1) Hex(5) HexNAc(3) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1530] === UNIMOD:1530 Hex(3)HexNAc(6)Sulf(2) |
null .Term [UNIMOD:1530] [cols="2*"] |
| id | UNIMOD:1530 | name | Hex(3)HexNAc(6)Sulf(2) | def | "Hex(3) HexNAc(6) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1530] | xref | record_id "1530" | xref | delta_mono_mass "1864.548335" | xref | delta_avge_mass "1865.7033" | xref | delta_composition "O(6) S(2) Hex(3) HexNAc(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:37:39" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1865_mono_mass "1864.548335" | xref | spec_1_neutral_loss_1865_avge_mass "1865.7033" | xref | spec_1_neutral_loss_1865_flag "false" | xref | spec_1_neutral_loss_1865_composition "O(6) S(2) Hex(3) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1531] === UNIMOD:1531 Hex(9)HexNAc(2) |
null .Term [UNIMOD:1531] [cols="2*"] |
| id | UNIMOD:1531 | name | Hex(9)HexNAc(2) | def | "Hex(9) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=9&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1531] | xref | record_id "1531" | xref | delta_mono_mass "1864.634157" | xref | delta_avge_mass "1865.6504" | xref | delta_composition "Hex(9) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1865_mono_mass "1864.634157" | xref | spec_1_neutral_loss_1865_avge_mass "1865.6504" | xref | spec_1_neutral_loss_1865_flag "false" | xref | spec_1_neutral_loss_1865_composition "Hex(9) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1532] === UNIMOD:1532 Hex(4)HexNAc(6) |
null .Term [UNIMOD:1532] [cols="2*"] |
| id | UNIMOD:1532 | name | Hex(4)HexNAc(6) | def | "Hex(4) HexNAc(6)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1532] | xref | record_id "1532" | xref | delta_mono_mass "1866.68753" | xref | delta_avge_mass "1867.7175" | xref | delta_composition "Hex(4) HexNAc(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1867_mono_mass "1866.68753" | xref | spec_1_neutral_loss_1867_avge_mass "1867.7175" | xref | spec_1_neutral_loss_1867_flag "false" | xref | spec_1_neutral_loss_1867_composition "Hex(4) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1533] === UNIMOD:1533 dHex(3)Hex(3)HexNAc(4)Pent(1) |
null .Term [UNIMOD:1533] [cols="2*"] |
| id | UNIMOD:1533 | name | dHex(3)Hex(3)HexNAc(4)Pent(1) | def | "DHex(3) Hex(3) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1533] | xref | record_id "1533" | xref | delta_mono_mass "1868.691946" | xref | delta_avge_mass "1869.7301" | xref | delta_composition "dHex(3) Hex(3) HexNAc(4) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1869_mono_mass "1868.691946" | xref | spec_1_neutral_loss_1869_avge_mass "1869.7301" | xref | spec_1_neutral_loss_1869_flag "false" | xref | spec_1_neutral_loss_1869_composition "dHex(3) Hex(3) HexNAc(4) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1534] === UNIMOD:1534 dHex(1)Hex(5)HexNAc(3)NeuGc(1) |
null .Term [UNIMOD:1534] [cols="2*"] |
| id | UNIMOD:1534 | name | dHex(1)Hex(5)HexNAc(3)NeuGc(1) | def | "DHex Hex(5) HexNAc(3) NeuGc ---OR--- Hex(6) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1534] | xref | record_id "1534" | xref | delta_mono_mass "1872.650475" | xref | delta_avge_mass "1873.6757" | xref | delta_composition "dHex Hex(5) HexNAc(3) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-22 11:15:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1873_mono_mass "1872.650475" | xref | spec_1_neutral_loss_1873_avge_mass "1873.6757" | xref | spec_1_neutral_loss_1873_flag "false" | xref | spec_1_neutral_loss_1873_composition "dHex Hex(5) HexNAc(3) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1535] === UNIMOD:1535 dHex(2)Hex(4)HexNAc(4)Pent(1) |
null .Term [UNIMOD:1535] [cols="2*"] |
| id | UNIMOD:1535 | name | dHex(2)Hex(4)HexNAc(4)Pent(1) | def | "DHex(2) Hex(4) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1535] | xref | record_id "1535" | xref | delta_mono_mass "1884.686861" | xref | delta_avge_mass "1885.7295" | xref | delta_composition "dHex(2) Hex(4) HexNAc(4) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1885_mono_mass "1884.686861" | xref | spec_1_neutral_loss_1885_avge_mass "1885.7295" | xref | spec_1_neutral_loss_1885_flag "false" | xref | spec_1_neutral_loss_1885_composition "dHex(2) Hex(4) HexNAc(4) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1536] === UNIMOD:1536 dHex(1)Hex(4)HexNAc(5)Sulf(1) |
null .Term [UNIMOD:1536] [cols="2*"] |
| id | UNIMOD:1536 | name | dHex(1)Hex(4)HexNAc(5)Sulf(1) | def | "DHex Hex(4) HexNAc(5) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1536] | xref | record_id "1536" | xref | delta_mono_mass "1889.62288" | xref | delta_avge_mass "1890.7294" | xref | delta_composition "O(3) S dHex Hex(4) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:37:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1890_mono_mass "1889.62288" | xref | spec_1_neutral_loss_1890_avge_mass "1890.7294" | xref | spec_1_neutral_loss_1890_flag "false" | xref | spec_1_neutral_loss_1890_composition "O(3) S dHex Hex(4) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1537] === UNIMOD:1537 dHex(1)Hex(7)HexNAc(3) |
null .Term [UNIMOD:1537] [cols="2*"] |
| id | UNIMOD:1537 | name | dHex(1)Hex(7)HexNAc(3) | def | "DHex Hex(7) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1537] | xref | record_id "1537" | xref | delta_mono_mass "1889.665791" | xref | delta_avge_mass "1890.703" | xref | delta_composition "dHex(1) Hex(7) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1890_mono_mass "1889.665791" | xref | spec_1_neutral_loss_1890_avge_mass "1890.703" | xref | spec_1_neutral_loss_1890_flag "false" | xref | spec_1_neutral_loss_1890_composition "dHex(1) Hex(7) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1538] === UNIMOD:1538 dHex(1)Hex(5)HexNAc(4)Pent(1) |
null .Term [UNIMOD:1538] [cols="2*"] |
| id | UNIMOD:1538 | name | dHex(1)Hex(5)HexNAc(4)Pent(1) | def | "DHex Hex(5) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1538] | xref | record_id "1538" | xref | delta_mono_mass "1900.681776" | xref | delta_avge_mass "1901.7289" | xref | delta_composition "dHex(1) Hex(5) HexNAc(4) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1901_mono_mass "1900.681776" | xref | spec_1_neutral_loss_1901_avge_mass "1901.7289" | xref | spec_1_neutral_loss_1901_flag "false" | xref | spec_1_neutral_loss_1901_composition "dHex(1) Hex(5) HexNAc(4) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1539] === UNIMOD:1539 dHex(1)Hex(5)HexA(1)HexNAc(3)Sulf(2) |
null .Term [UNIMOD:1539] [cols="2*"] |
| id | UNIMOD:1539 | name | dHex(1)Hex(5)HexA(1)HexNAc(3)Sulf(2) | def | "DHex Hex(5) HexA HexNAc(3) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=1&hex=5&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1539] | xref | record_id "1539" | xref | delta_mono_mass "1901.505861" | xref | delta_avge_mass "1902.6723" | xref | delta_composition "O(6) S(2) dHex Hex(5) HexA HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:38:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1902_mono_mass "1901.505861" | xref | spec_1_neutral_loss_1902_avge_mass "1902.6723" | xref | spec_1_neutral_loss_1902_flag "false" | xref | spec_1_neutral_loss_1902_composition "O(6) S(2) dHex Hex(5) HexA HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1540] === UNIMOD:1540 Hex(3)HexNAc(7) |
null .Term [UNIMOD:1540] [cols="2*"] |
| id | UNIMOD:1540 | name | Hex(3)HexNAc(7) | def | "Hex(3) HexNAc(7)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=7&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1540] | xref | record_id "1540" | xref | delta_mono_mass "1907.714079" | xref | delta_avge_mass "1908.7694" | xref | delta_composition "Hex(3) HexNAc(7)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1908_mono_mass "1907.714079" | xref | spec_1_neutral_loss_1908_avge_mass "1908.7694" | xref | spec_1_neutral_loss_1908_flag "false" | xref | spec_1_neutral_loss_1908_composition "Hex(3) HexNAc(7)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1541] === UNIMOD:1541 dHex(2)Hex(5)HexNAc(4) |
null .Term [UNIMOD:1541] [cols="2*"] |
| id | UNIMOD:1541 | name | dHex(2)Hex(5)HexNAc(4) | def | "DHex(2) Hex(5) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1541] | xref | record_id "1541" | xref | delta_mono_mass "1914.697426" | xref | delta_avge_mass "1915.7555" | xref | delta_composition "dHex(2) Hex(5) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1915_mono_mass "1914.697426" | xref | spec_1_neutral_loss_1915_avge_mass "1915.7555" | xref | spec_1_neutral_loss_1915_flag "false" | xref | spec_1_neutral_loss_1915_composition "dHex(2) Hex(5) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1542] === UNIMOD:1542 dHex(2)Hex(4)HexNAc(3)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1542] [cols="2*"] |
| id | UNIMOD:1542 | name | dHex(2)Hex(4)HexNAc(3)NeuAc(1)Sulf(1) | def | "DHex(2) Hex(4) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=4&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1542] | xref | record_id "1542" | xref | delta_mono_mass "1920.617461" | xref | delta_avge_mass "1921.7401" | xref | delta_composition "O(3) S dHex(2) Hex(4) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:38:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1921_mono_mass "1920.617461" | xref | spec_1_neutral_loss_1921_avge_mass "1921.7401" | xref | spec_1_neutral_loss_1921_flag "false" | xref | spec_1_neutral_loss_1921_composition "O(3) S dHex(2) Hex(4) HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1543] === UNIMOD:1543 dHex(1)Hex(5)HexNAc(4)Sulf(2) |
null .Term [UNIMOD:1543] [cols="2*"] |
| id | UNIMOD:1543 | name | dHex(1)Hex(5)HexNAc(4)Sulf(2) | def | "DHex Hex(5) HexNAc(4) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=1&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1543] | xref | record_id "1543" | xref | delta_mono_mass "1928.553146" | xref | delta_avge_mass "1929.7407" | xref | delta_composition "O(6) S(2) dHex Hex(5) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:39:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1929_mono_mass "1928.553146" | xref | spec_1_neutral_loss_1929_avge_mass "1929.7407" | xref | spec_1_neutral_loss_1929_flag "false" | xref | spec_1_neutral_loss_1929_composition "O(6) S(2) dHex Hex(5) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1544] === UNIMOD:1544 dHex(1)Hex(5)HexNAc(4)Me(2)Pent(1) |
null .Term [UNIMOD:1544] [cols="2*"] |
| id | UNIMOD:1544 | name | dHex(1)Hex(5)HexNAc(4)Me(2)Pent(1) | def | "DHex Hex(5) HexNAc(4) Me(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&methyl=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1544] | xref | record_id "1544" | xref | delta_mono_mass "1928.713076" | xref | delta_avge_mass "1929.7821" | xref | delta_composition "dHex(1) Hex(5) HexNAc(4) Me(2) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1929_mono_mass "1928.713076" | xref | spec_1_neutral_loss_1929_avge_mass "1929.7821" | xref | spec_1_neutral_loss_1929_flag "false" | xref | spec_1_neutral_loss_1929_composition "dHex(1) Hex(5) HexNAc(4) Me(2) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1545] === UNIMOD:1545 Hex(5)HexNAc(4)NeuGc(1) |
null .Term [UNIMOD:1545] [cols="2*"] |
| id | UNIMOD:1545 | name | Hex(5)HexNAc(4)NeuGc(1) | def | "Hex(5) HexNAc(4) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1545] | xref | record_id "1545" | xref | delta_mono_mass "1929.671939" | xref | delta_avge_mass "1930.7271" | xref | delta_composition "Hex(5) HexNAc(4) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1930_mono_mass "1929.671939" | xref | spec_1_neutral_loss_1930_avge_mass "1930.7271" | xref | spec_1_neutral_loss_1930_flag "false" | xref | spec_1_neutral_loss_1930_composition "Hex(5) HexNAc(4) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1546] === UNIMOD:1546 dHex(1)Hex(3)HexNAc(6)Sulf(1) |
null .Term [UNIMOD:1546] [cols="2*"] |
| id | UNIMOD:1546 | name | dHex(1)Hex(3)HexNAc(6)Sulf(1) | def | "DHex Hex(3) HexNAc(6) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1546] | xref | record_id "1546" | xref | delta_mono_mass "1930.64943" | xref | delta_avge_mass "1931.7813" | xref | delta_composition "O(3) S dHex Hex(3) HexNAc(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:39:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1931_mono_mass "1930.64943" | xref | spec_1_neutral_loss_1931_avge_mass "1931.7813" | xref | spec_1_neutral_loss_1931_flag "false" | xref | spec_1_neutral_loss_1931_composition "O(3) S dHex Hex(3) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1547] === UNIMOD:1547 dHex(1)Hex(6)HexNAc(4) |
null .Term [UNIMOD:1547] [cols="2*"] |
| id | UNIMOD:1547 | name | dHex(1)Hex(6)HexNAc(4) | def | "DHex Hex(6) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=6&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1547] | xref | record_id "1547" | xref | delta_mono_mass "1930.69234" | xref | delta_avge_mass "1931.7549" | xref | delta_composition "dHex(1) Hex(6) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1931_mono_mass "1930.69234" | xref | spec_1_neutral_loss_1931_avge_mass "1931.7549" | xref | spec_1_neutral_loss_1931_flag "false" | xref | spec_1_neutral_loss_1931_composition "dHex(1) Hex(6) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1548] === UNIMOD:1548 dHex(1)Hex(5)HexNAc(3)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1548] [cols="2*"] |
| id | UNIMOD:1548 | name | dHex(1)Hex(5)HexNAc(3)NeuAc(1)Sulf(1) | def | "DHex Hex(5) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1548] | xref | record_id "1548" | xref | delta_mono_mass "1936.612375" | xref | delta_avge_mass "1937.7395" | xref | delta_composition "O(3) S dHex Hex(5) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:39:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1937_mono_mass "1936.612375" | xref | spec_1_neutral_loss_1937_avge_mass "1937.7395" | xref | spec_1_neutral_loss_1937_flag "false" | xref | spec_1_neutral_loss_1937_composition "O(3) S dHex Hex(5) HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1549] === UNIMOD:1549 Hex(7)HexNAc(4) |
null .Term [UNIMOD:1549] [cols="2*"] |
| id | UNIMOD:1549 | name | Hex(7)HexNAc(4) | def | "Hex(7) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=7&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1549] | xref | record_id "1549" | xref | delta_mono_mass "1946.687255" | xref | delta_avge_mass "1947.7543" | xref | delta_composition "Hex(7) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1947_mono_mass "1946.687255" | xref | spec_1_neutral_loss_1947_avge_mass "1947.7543" | xref | spec_1_neutral_loss_1947_flag "false" | xref | spec_1_neutral_loss_1947_composition "Hex(7) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1550] === UNIMOD:1550 dHex(1)Hex(5)HexNAc(3)NeuGc(1)Sulf(1) |
null .Term [UNIMOD:1550] [cols="2*"] |
| id | UNIMOD:1550 | name | dHex(1)Hex(5)HexNAc(3)NeuGc(1)Sulf(1) | def | "DHex Hex(5) HexNAc(3) NeuGc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1550] | xref | record_id "1550" | xref | delta_mono_mass "1952.60729" | xref | delta_avge_mass "1953.7389" | xref | delta_composition "O(3) S dHex Hex(5) HexNAc(3) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:39:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1953_mono_mass "1952.60729" | xref | spec_1_neutral_loss_1953_avge_mass "1953.7389" | xref | spec_1_neutral_loss_1953_flag "false" | xref | spec_1_neutral_loss_1953_composition "O(3) S dHex Hex(5) HexNAc(3) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1551] === UNIMOD:1551 Hex(4)HexNAc(5)NeuAc(1) |
null .Term [UNIMOD:1551] [cols="2*"] |
| id | UNIMOD:1551 | name | Hex(4)HexNAc(5)NeuAc(1) | def | "Hex(4) HexNAc(5) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=5&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1551] | xref | record_id "1551" | xref | delta_mono_mass "1954.703574" | xref | delta_avge_mass "1955.7796" | xref | delta_composition "Hex(4) HexNAc(5) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1955_mono_mass "1954.703574" | xref | spec_1_neutral_loss_1955_avge_mass "1955.7796" | xref | spec_1_neutral_loss_1955_flag "false" | xref | spec_1_neutral_loss_1955_composition "Hex(4) HexNAc(5) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1552] === UNIMOD:1552 Hex(6)HexNAc(4)Me(3)Pent(1) |
null .Term [UNIMOD:1552] [cols="2*"] |
| id | UNIMOD:1552 | name | Hex(6)HexNAc(4)Me(3)Pent(1) | def | "Hex(6) HexNAc(4) Me(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=4&methyl=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1552] | xref | record_id "1552" | xref | delta_mono_mass "1958.72364" | xref | delta_avge_mass "1959.808" | xref | delta_composition "Hex(6) HexNAc(4) Me(3) Pent(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1959_mono_mass "1958.72364" | xref | spec_1_neutral_loss_1959_avge_mass "1959.808" | xref | spec_1_neutral_loss_1959_flag "false" | xref | spec_1_neutral_loss_1959_composition "Hex(6) HexNAc(4) Me(3) Pent(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1553] === UNIMOD:1553 dHex(1)Hex(7)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1553] [cols="2*"] |
| id | UNIMOD:1553 | name | dHex(1)Hex(7)HexNAc(3)Sulf(1) | def | "DHex Hex(7) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1553] | xref | record_id "1553" | xref | delta_mono_mass "1969.622606" | xref | delta_avge_mass "1970.7662" | xref | delta_composition "O(3) S dHex Hex(7) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:40:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1970_mono_mass "1969.622606" | xref | spec_1_neutral_loss_1970_avge_mass "1970.7662" | xref | spec_1_neutral_loss_1970_flag "false" | xref | spec_1_neutral_loss_1970_composition "O(3) S dHex Hex(7) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1554] === UNIMOD:1554 dHex(1)Hex(7)HexNAc(3)Phos(1) |
null .Term [UNIMOD:1554] [cols="2*"] |
| id | UNIMOD:1554 | name | dHex(1)Hex(7)HexNAc(3)Phos(1) | def | "DHex Hex(7) HexNAc(3) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&dhex=1&hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1554] | xref | record_id "1554" | xref | delta_mono_mass "1969.632122" | xref | delta_avge_mass "1970.6829" | xref | delta_composition "H O(3) P dHex Hex(7) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:44:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1970_mono_mass "1969.632122" | xref | spec_1_neutral_loss_1970_avge_mass "1970.6829" | xref | spec_1_neutral_loss_1970_flag "false" | xref | spec_1_neutral_loss_1970_composition "H O(3) P dHex Hex(7) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1555] === UNIMOD:1555 dHex(1)Hex(5)HexNAc(5) |
null .Term [UNIMOD:1555] [cols="2*"] |
| id | UNIMOD:1555 | name | dHex(1)Hex(5)HexNAc(5) | def | "DHex Hex(5) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1555] | xref | record_id "1555" | xref | delta_mono_mass "1971.718889" | xref | delta_avge_mass "1972.8068" | xref | delta_composition "dHex(1) Hex(5) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1972_mono_mass "1971.718889" | xref | spec_1_neutral_loss_1972_avge_mass "1972.8068" | xref | spec_1_neutral_loss_1972_flag "false" | xref | spec_1_neutral_loss_1972_composition "dHex(1) Hex(5) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1556] === UNIMOD:1556 dHex(1)Hex(4)HexNAc(4)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1556] [cols="2*"] |
| id | UNIMOD:1556 | name | dHex(1)Hex(4)HexNAc(4)NeuAc(1)Sulf(1) | def | "DHex Hex(4) HexNAc(4) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1556] | xref | record_id "1556" | xref | delta_mono_mass "1977.638925" | xref | delta_avge_mass "1978.7915" | xref | delta_composition "O(3) S dHex Hex(4) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:40:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1978_mono_mass "1977.638925" | xref | spec_1_neutral_loss_1978_avge_mass "1978.7915" | xref | spec_1_neutral_loss_1978_flag "false" | xref | spec_1_neutral_loss_1978_composition "O(3) S dHex Hex(4) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1557] === UNIMOD:1557 dHex(3)Hex(4)HexNAc(4)Sulf(1) |
null .Term [UNIMOD:1557] [cols="2*"] |
| id | UNIMOD:1557 | name | dHex(3)Hex(4)HexNAc(4)Sulf(1) | def | "DHex(3) Hex(4) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=3&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1557] | xref | record_id "1557" | xref | delta_mono_mass "1978.659326" | xref | delta_avge_mass "1979.8193" | xref | delta_composition "O(3) S dHex(3) Hex(4) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:40:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1979_mono_mass "1978.659326" | xref | spec_1_neutral_loss_1979_avge_mass "1979.8193" | xref | spec_1_neutral_loss_1979_flag "false" | xref | spec_1_neutral_loss_1979_composition "O(3) S dHex(3) Hex(4) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1558] === UNIMOD:1558 Hex(3)HexNAc(7)Sulf(1) |
null .Term [UNIMOD:1558] [cols="2*"] |
| id | UNIMOD:1558 | name | Hex(3)HexNAc(7)Sulf(1) | def | "Hex(3) HexNAc(7) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=7&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1558] | xref | record_id "1558" | xref | delta_mono_mass "1987.670893" | xref | delta_avge_mass "1988.8326" | xref | delta_composition "O(3) S Hex(3) HexNAc(7)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:40:39" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1988_mono_mass "1987.670893" | xref | spec_1_neutral_loss_1988_avge_mass "1988.8326" | xref | spec_1_neutral_loss_1988_flag "false" | xref | spec_1_neutral_loss_1988_composition "O(3) S Hex(3) HexNAc(7)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1559] === UNIMOD:1559 Hex(6)HexNAc(5) |
null .Term [UNIMOD:1559] [cols="2*"] |
| id | UNIMOD:1559 | name | Hex(6)HexNAc(5) | def | "Hex(6) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1559] | xref | record_id "1559" | xref | delta_mono_mass "1987.713804" | xref | delta_avge_mass "1988.8062" | xref | delta_composition "Hex(6) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1988_mono_mass "1987.713804" | xref | spec_1_neutral_loss_1988_avge_mass "1988.8062" | xref | spec_1_neutral_loss_1988_flag "false" | xref | spec_1_neutral_loss_1988_composition "Hex(6) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1560] === UNIMOD:1560 Hex(5)HexNAc(4)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1560] [cols="2*"] |
| id | UNIMOD:1560 | name | Hex(5)HexNAc(4)NeuAc(1)Sulf(1) | def | "Hex(5) HexNAc(4) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1560] | xref | record_id "1560" | xref | delta_mono_mass "1993.633839" | xref | delta_avge_mass "1994.7909" | xref | delta_composition "O(3) S Hex(5) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:40:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1994_mono_mass "1993.633839" | xref | spec_1_neutral_loss_1994_avge_mass "1994.7909" | xref | spec_1_neutral_loss_1994_flag "false" | xref | spec_1_neutral_loss_1994_composition "O(3) S Hex(5) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1561] === UNIMOD:1561 Hex(3)HexNAc(6)NeuAc(1) |
null .Term [UNIMOD:1561] [cols="2*"] |
| id | UNIMOD:1561 | name | Hex(3)HexNAc(6)NeuAc(1) | def | "Hex(3) HexNAc(6) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=6&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1561] | xref | record_id "1561" | xref | delta_mono_mass "1995.730123" | xref | delta_avge_mass "1996.8315" | xref | delta_composition "Hex(3) HexNAc(6) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1996_mono_mass "1995.730123" | xref | spec_1_neutral_loss_1996_avge_mass "1996.8315" | xref | spec_1_neutral_loss_1996_flag "false" | xref | spec_1_neutral_loss_1996_composition "Hex(3) HexNAc(6) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1562] === UNIMOD:1562 dHex(2)Hex(3)HexNAc(6) |
null .Term [UNIMOD:1562] [cols="2*"] |
| id | UNIMOD:1562 | name | dHex(2)Hex(3)HexNAc(6) | def | "DHex(2) Hex(3) HexNAc(6)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1562] | xref | record_id "1562" | xref | delta_mono_mass "1996.750524" | xref | delta_avge_mass "1997.8593" | xref | delta_composition "dHex(2) Hex(3) HexNAc(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1997_mono_mass "1996.750524" | xref | spec_1_neutral_loss_1997_avge_mass "1997.8593" | xref | spec_1_neutral_loss_1997_flag "false" | xref | spec_1_neutral_loss_1997_composition "dHex(2) Hex(3) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1563] === UNIMOD:1563 Hex(1)HexNAc(1)NeuGc(1) |
null .Term [UNIMOD:1563] [cols="2*"] |
| id | UNIMOD:1563 | name | Hex(1)HexNAc(1)NeuGc(1) | def | "Hex HexNAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1563] | xref | record_id "1563" | xref | delta_mono_mass "672.222527" | xref | delta_avge_mass "672.5871" | xref | delta_composition "Hex(1) HexNAc(1) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_673_mono_mass "672.222527" | xref | spec_1_neutral_loss_673_avge_mass "672.5871" | xref | spec_1_neutral_loss_673_flag "false" | xref | spec_1_neutral_loss_673_composition "Hex(1) HexNAc(1) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_673_mono_mass "672.222527" | xref | spec_1_neutral_loss_673_avge_mass "672.5871" | xref | spec_1_neutral_loss_673_flag "false" | xref | spec_1_neutral_loss_673_composition "Hex(1) HexNAc(1) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1564] === UNIMOD:1564 dHex(1)Hex(2)HexNAc(1) |
null .Term [UNIMOD:1564] [cols="2*"] |
| id | UNIMOD:1564 | name | dHex(1)Hex(2)HexNAc(1) | def | "DHex Hex(2) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1564] | xref | record_id "1564" | xref | delta_mono_mass "673.242928" | xref | delta_avge_mass "673.6149" | xref | delta_composition "dHex(1) Hex(2) HexNAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_674_mono_mass "673.242928" | xref | spec_1_neutral_loss_674_avge_mass "673.6149" | xref | spec_1_neutral_loss_674_flag "false" | xref | spec_1_neutral_loss_674_composition "dHex(1) Hex(2) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_674_mono_mass "673.242928" | xref | spec_1_neutral_loss_674_avge_mass "673.6149" | xref | spec_1_neutral_loss_674_flag "false" | xref | spec_1_neutral_loss_674_composition "dHex(1) Hex(2) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1565] === UNIMOD:1565 HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1565] [cols="2*"] |
| id | UNIMOD:1565 | name | HexNAc(3)Sulf(1) | def | "HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1565] | xref | record_id "1565" | xref | delta_mono_mass "689.194932" | xref | delta_avge_mass "689.6408" | xref | delta_composition "O(3) S HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:26:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_690_mono_mass "689.194932" | xref | spec_1_neutral_loss_690_avge_mass "689.6408" | xref | spec_1_neutral_loss_690_flag "false" | xref | spec_1_neutral_loss_690_composition "O(3) S HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_690_mono_mass "689.194932" | xref | spec_1_neutral_loss_690_avge_mass "689.6408" | xref | spec_1_neutral_loss_690_flag "false" | xref | spec_1_neutral_loss_690_composition "O(3) S HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1566] === UNIMOD:1566 Hex(3)HexNAc(1) |
null .Term [UNIMOD:1566] [cols="2*"] |
| id | UNIMOD:1566 | name | Hex(3)HexNAc(1) | def | "Hex(3) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1566] | xref | record_id "1566" | xref | delta_mono_mass "689.237843" | xref | delta_avge_mass "689.6143" | xref | delta_composition "Hex(3) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-23 17:47:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_690_mono_mass "689.237843" | xref | spec_1_neutral_loss_690_avge_mass "689.6143" | xref | spec_1_neutral_loss_690_flag "false" | xref | spec_1_neutral_loss_690_composition "Hex(3) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_690_mono_mass "689.237843" | xref | spec_1_neutral_loss_690_avge_mass "689.6143" | xref | spec_1_neutral_loss_690_flag "false" | xref | spec_1_neutral_loss_690_composition "Hex(3) HexNAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_690_mono_mass "689.237843" | xref | spec_2_neutral_loss_690_avge_mass "689.6143" | xref | spec_2_neutral_loss_690_flag "false" | xref | spec_2_neutral_loss_690_composition "Hex(3) HexNAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1567] === UNIMOD:1567 Hex(1)HexNAc(1)Kdn(1)Sulf(1) |
null .Term [UNIMOD:1567] [cols="2*"] |
| id | UNIMOD:1567 | name | Hex(1)HexNAc(1)Kdn(1)Sulf(1) | def | "Hex HexNAc Kdn Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=1&kdn=1)mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1567] | xref | record_id "1567" | xref | delta_mono_mass "695.157878" | xref | delta_avge_mass "695.599" | xref | delta_composition "O(3) S Hex HexNAc Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:26:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_696_mono_mass "695.157878" | xref | spec_1_neutral_loss_696_avge_mass "695.599" | xref | spec_1_neutral_loss_696_flag "false" | xref | spec_1_neutral_loss_696_composition "O(3) S Hex HexNAc Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_696_mono_mass "695.157878" | xref | spec_1_neutral_loss_696_avge_mass "695.599" | xref | spec_1_neutral_loss_696_flag "false" | xref | spec_1_neutral_loss_696_composition "O(3) S Hex HexNAc Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1568] === UNIMOD:1568 HexNAc(2)NeuAc(1) |
null .Term [UNIMOD:1568] [cols="2*"] |
| id | UNIMOD:1568 | name | HexNAc(2)NeuAc(1) | def | "HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1568] | xref | record_id "1568" | xref | delta_mono_mass "697.254162" | xref | delta_avge_mass "697.6396" | xref | delta_composition "HexNAc(2) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_698_mono_mass "697.254162" | xref | spec_1_neutral_loss_698_avge_mass "697.6396" | xref | spec_1_neutral_loss_698_flag "false" | xref | spec_1_neutral_loss_698_composition "HexNAc(2) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_698_mono_mass "697.254162" | xref | spec_1_neutral_loss_698_avge_mass "697.6396" | xref | spec_1_neutral_loss_698_flag "false" | xref | spec_1_neutral_loss_698_composition "HexNAc(2) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1570] === UNIMOD:1570 HexNAc(1)Kdn(2) |
null .Term [UNIMOD:1570] [cols="2*"] |
| id | UNIMOD:1570 | name | HexNAc(1)Kdn(2) | def | "HexNAc Kdn(2) ---OR--- Hex(2) HexNAc HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&kdn=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1570] | xref | record_id "1570" | xref | delta_mono_mass "703.217108" | xref | delta_avge_mass "703.5978" | xref | delta_composition "HexNAc Kdn(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 11:43:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_704_mono_mass "703.217108" | xref | spec_1_neutral_loss_704_avge_mass "703.5978" | xref | spec_1_neutral_loss_704_flag "false" | xref | spec_1_neutral_loss_704_composition "HexNAc Kdn(2)" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_704_mono_mass "703.217108" | xref | spec_1_neutral_loss_704_avge_mass "703.5978" | xref | spec_1_neutral_loss_704_flag "false" | xref | spec_1_neutral_loss_704_composition "HexNAc Kdn(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1571] === UNIMOD:1571 Hex(3)HexNAc(1)Me(1) |
null .Term [UNIMOD:1571] [cols="2*"] |
| id | UNIMOD:1571 | name | Hex(3)HexNAc(1)Me(1) | def | "Hex(3) HexNAc Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=1&methyl=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1571] | xref | record_id "1571" | xref | delta_mono_mass "703.253493" | xref | delta_avge_mass "703.6409" | xref | delta_composition "Hex(3) HexNAc(1) Me(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_704_mono_mass "703.253493" | xref | spec_1_neutral_loss_704_avge_mass "703.6409" | xref | spec_1_neutral_loss_704_flag "false" | xref | spec_1_neutral_loss_704_composition "Hex(3) HexNAc(1) Me(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_704_mono_mass "703.253493" | xref | spec_1_neutral_loss_704_avge_mass "703.6409" | xref | spec_1_neutral_loss_704_flag "false" | xref | spec_1_neutral_loss_704_composition "Hex(3) HexNAc(1) Me(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1572] === UNIMOD:1572 Hex(2)HexA(1)Pent(1)Sulf(1) |
null .Term [UNIMOD:1572] [cols="2*"] |
| id | UNIMOD:1572 | name | Hex(2)HexA(1)Pent(1)Sulf(1) | def | "Hex(2) HexA Pent Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&pent=1&hex=2&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1572] | xref | record_id "1572" | xref | delta_mono_mass "712.136808" | xref | delta_avge_mass "712.5831" | xref | delta_composition "O(3) S Pent Hex(2) HexA" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:27:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_713_mono_mass "712.136808" | xref | spec_1_neutral_loss_713_avge_mass "712.5831" | xref | spec_1_neutral_loss_713_flag "false" | xref | spec_1_neutral_loss_713_composition "O(3) S Pent Hex(2) HexA" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_713_mono_mass "712.136808" | xref | spec_1_neutral_loss_713_avge_mass "712.5831" | xref | spec_1_neutral_loss_713_flag "false" | xref | spec_1_neutral_loss_713_composition "O(3) S Pent Hex(2) HexA" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1573] === UNIMOD:1573 HexNAc(2)NeuGc(1) |
null .Term [UNIMOD:1573] [cols="2*"] |
| id | UNIMOD:1573 | name | HexNAc(2)NeuGc(1) | def | "HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1573] | xref | record_id "1573" | xref | delta_mono_mass "713.249076" | xref | delta_avge_mass "713.639" | xref | delta_composition "HexNAc(2) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_714_mono_mass "713.249076" | xref | spec_1_neutral_loss_714_avge_mass "713.639" | xref | spec_1_neutral_loss_714_flag "false" | xref | spec_1_neutral_loss_714_composition "HexNAc(2) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_714_mono_mass "713.249076" | xref | spec_1_neutral_loss_714_avge_mass "713.639" | xref | spec_1_neutral_loss_714_flag "false" | xref | spec_1_neutral_loss_714_composition "HexNAc(2) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1575] === UNIMOD:1575 Hex(4)Phos(1) |
null .Term [UNIMOD:1575] [cols="2*"] |
| id | UNIMOD:1575 | name | Hex(4)Phos(1) | def | "Hex(4) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1575] | xref | record_id "1575" | xref | delta_mono_mass "728.177625" | xref | delta_avge_mass "728.5423" | xref | delta_composition "H O(3) P Hex(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:42:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_729_mono_mass "728.177625" | xref | spec_1_neutral_loss_729_avge_mass "728.5423" | xref | spec_1_neutral_loss_729_flag "false" | xref | spec_1_neutral_loss_729_composition "H O(3) P Hex(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_729_mono_mass "728.177625" | xref | spec_1_neutral_loss_729_avge_mass "728.5423" | xref | spec_1_neutral_loss_729_flag "false" | xref | spec_1_neutral_loss_729_composition "H O(3) P Hex(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1577] === UNIMOD:1577 Hex(1)HexNAc(1)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1577] [cols="2*"] |
| id | UNIMOD:1577 | name | Hex(1)HexNAc(1)NeuAc(1)Sulf(1) | def | "Hex HexNAc NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1577] | xref | record_id "1577" | xref | delta_mono_mass "736.184427" | xref | delta_avge_mass "736.6509" | xref | delta_composition "O(3) S Hex HexNAc NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:27:24" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_737_mono_mass "736.184427" | xref | spec_1_neutral_loss_737_avge_mass "736.6509" | xref | spec_1_neutral_loss_737_flag "false" | xref | spec_1_neutral_loss_737_composition "O(3) S Hex HexNAc NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_737_mono_mass "736.184427" | xref | spec_1_neutral_loss_737_avge_mass "736.6509" | xref | spec_1_neutral_loss_737_flag "false" | xref | spec_1_neutral_loss_737_composition "O(3) S Hex HexNAc NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1578] === UNIMOD:1578 Hex(1)HexA(1)HexNAc(2) |
null .Term [UNIMOD:1578] [cols="2*"] |
| id | UNIMOD:1578 | name | Hex(1)HexA(1)HexNAc(2) | def | "Hex HexA HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1578] | xref | record_id "1578" | xref | delta_mono_mass "744.243657" | xref | delta_avge_mass "744.6498" | xref | delta_composition "Hex(1) HexA(1) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_745_mono_mass "744.243657" | xref | spec_1_neutral_loss_745_avge_mass "744.6498" | xref | spec_1_neutral_loss_745_flag "false" | xref | spec_1_neutral_loss_745_composition "Hex(1) HexA(1) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_745_mono_mass "744.243657" | xref | spec_1_neutral_loss_745_avge_mass "744.6498" | xref | spec_1_neutral_loss_745_flag "false" | xref | spec_1_neutral_loss_745_composition "Hex(1) HexA(1) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1579] === UNIMOD:1579 dHex(1)Hex(2)HexNAc(1)Sulf(1) |
null .Term [UNIMOD:1579] [cols="2*"] |
| id | UNIMOD:1579 | name | dHex(1)Hex(2)HexNAc(1)Sulf(1) | def | "DHex Hex(2) HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1579] | xref | record_id "1579" | xref | delta_mono_mass "753.199743" | xref | delta_avge_mass "753.6781" | xref | delta_composition "O(3) S dHex Hex(2) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:27:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_754_mono_mass "753.199743" | xref | spec_1_neutral_loss_754_avge_mass "753.6781" | xref | spec_1_neutral_loss_754_flag "false" | xref | spec_1_neutral_loss_754_composition "O(3) S dHex Hex(2) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_754_mono_mass "753.199743" | xref | spec_1_neutral_loss_754_avge_mass "753.6781" | xref | spec_1_neutral_loss_754_flag "false" | xref | spec_1_neutral_loss_754_composition "O(3) S dHex Hex(2) HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1580] === UNIMOD:1580 dHex(1)HexNAc(3) |
null .Term [UNIMOD:1580] [cols="2*"] |
| id | UNIMOD:1580 | name | dHex(1)HexNAc(3) | def | "DHex HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1580] | xref | record_id "1580" | xref | delta_mono_mass "755.296027" | xref | delta_avge_mass "755.7188" | xref | delta_composition "dHex(1) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_756_mono_mass "755.296027" | xref | spec_1_neutral_loss_756_avge_mass "755.7188" | xref | spec_1_neutral_loss_756_flag "false" | xref | spec_1_neutral_loss_756_composition "dHex(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_756_mono_mass "755.296027" | xref | spec_1_neutral_loss_756_avge_mass "755.7188" | xref | spec_1_neutral_loss_756_flag "false" | xref | spec_1_neutral_loss_756_composition "dHex(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1581] === UNIMOD:1581 dHex(1)Hex(1)HexNAc(1)Kdn(1) |
null .Term [UNIMOD:1581] [cols="2*"] |
| id | UNIMOD:1581 | name | dHex(1)Hex(1)HexNAc(1)Kdn(1) | def | "DHex Hex HexNAc Kdn ---OR--- Hex(2) dHex NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=1&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1581] | xref | record_id "1581" | xref | delta_mono_mass "761.258973" | xref | delta_avge_mass "761.677" | xref | delta_composition "dHex Hex HexNAc Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 11:43:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_762_mono_mass "761.258973" | xref | spec_1_neutral_loss_762_avge_mass "761.677" | xref | spec_1_neutral_loss_762_flag "false" | xref | spec_1_neutral_loss_762_composition "dHex Hex HexNAc Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_762_mono_mass "761.258973" | xref | spec_1_neutral_loss_762_avge_mass "761.677" | xref | spec_1_neutral_loss_762_flag "false" | xref | spec_1_neutral_loss_762_composition "dHex Hex HexNAc Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1582] === UNIMOD:1582 Hex(1)HexNAc(3) |
null .Term [UNIMOD:1582] [cols="2*"] |
| id | UNIMOD:1582 | name | Hex(1)HexNAc(3) | def | "Hex HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1582] | xref | record_id "1582" | xref | delta_mono_mass "771.290941" | xref | delta_avge_mass "771.7182" | xref | delta_composition "Hex(1) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_772_mono_mass "771.290941" | xref | spec_1_neutral_loss_772_avge_mass "771.7182" | xref | spec_1_neutral_loss_772_flag "false" | xref | spec_1_neutral_loss_772_composition "Hex(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_772_mono_mass "771.290941" | xref | spec_1_neutral_loss_772_avge_mass "771.7182" | xref | spec_1_neutral_loss_772_flag "false" | xref | spec_1_neutral_loss_772_composition "Hex(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1583] === UNIMOD:1583 HexNAc(2)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1583] [cols="2*"] |
| id | UNIMOD:1583 | name | HexNAc(2)NeuAc(1)Sulf(1) | def | "HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1583] | xref | record_id "1583" | xref | delta_mono_mass "777.210976" | xref | delta_avge_mass "777.7028" | xref | delta_composition "O(3) S HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:27:46" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_778_mono_mass "777.210976" | xref | spec_1_neutral_loss_778_avge_mass "777.7028" | xref | spec_1_neutral_loss_778_flag "false" | xref | spec_1_neutral_loss_778_composition "O(3) S HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_778_mono_mass "777.210976" | xref | spec_1_neutral_loss_778_avge_mass "777.7028" | xref | spec_1_neutral_loss_778_flag "false" | xref | spec_1_neutral_loss_778_composition "O(3) S HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1584] === UNIMOD:1584 dHex(2)Hex(3) |
null .Term [UNIMOD:1584] [cols="2*"] |
| id | UNIMOD:1584 | name | dHex(2)Hex(3) | def | "DHex(2) Hex(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1584] | xref | record_id "1584" | xref | delta_mono_mass "778.274288" | xref | delta_avge_mass "778.7042" | xref | delta_composition "dHex(2) Hex(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_779_mono_mass "778.274288" | xref | spec_1_neutral_loss_779_avge_mass "778.7042" | xref | spec_1_neutral_loss_779_flag "false" | xref | spec_1_neutral_loss_779_composition "dHex(2) Hex(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_779_mono_mass "778.274288" | xref | spec_1_neutral_loss_779_avge_mass "778.7042" | xref | spec_1_neutral_loss_779_flag "false" | xref | spec_1_neutral_loss_779_composition "dHex(2) Hex(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1585] === UNIMOD:1585 Hex(2)HexA(1)HexNAc(1)Sulf(1) |
null .Term [UNIMOD:1585] [cols="2*"] |
| id | UNIMOD:1585 | name | Hex(2)HexA(1)HexNAc(1)Sulf(1) | def | "Hex(2) HexA HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1585] | xref | record_id "1585" | xref | delta_mono_mass "783.173922" | xref | delta_avge_mass "783.661" | xref | delta_composition "O(3) S Hex(2) HexA HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:28:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_784_mono_mass "783.173922" | xref | spec_1_neutral_loss_784_avge_mass "783.661" | xref | spec_1_neutral_loss_784_flag "false" | xref | spec_1_neutral_loss_784_composition "O(3) S Hex(2) HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_784_mono_mass "783.173922" | xref | spec_1_neutral_loss_784_avge_mass "783.661" | xref | spec_1_neutral_loss_784_flag "false" | xref | spec_1_neutral_loss_784_composition "O(3) S Hex(2) HexA HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1586] === UNIMOD:1586 dHex(2)Hex(2)HexA(1) |
null .Term [UNIMOD:1586] [cols="2*"] |
| id | UNIMOD:1586 | name | dHex(2)Hex(2)HexA(1) | def | "DHex(2) Hex(2) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1586] | xref | record_id "1586" | xref | delta_mono_mass "792.253553" | xref | delta_avge_mass "792.6877" | xref | delta_composition "dHex(2) Hex(2) HexA(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_793_mono_mass "792.253553" | xref | spec_1_neutral_loss_793_avge_mass "792.6877" | xref | spec_1_neutral_loss_793_flag "false" | xref | spec_1_neutral_loss_793_composition "dHex(2) Hex(2) HexA(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_793_mono_mass "792.253553" | xref | spec_1_neutral_loss_793_avge_mass "792.6877" | xref | spec_1_neutral_loss_793_flag "false" | xref | spec_1_neutral_loss_793_composition "dHex(2) Hex(2) HexA(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1587] === UNIMOD:1587 dHex(1)Hex(1)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1587] [cols="2*"] |
| id | UNIMOD:1587 | name | dHex(1)Hex(1)HexNAc(2)Sulf(1) | def | "DHex Hex HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1587] | xref | record_id "1587" | xref | delta_mono_mass "794.226292" | xref | delta_avge_mass "794.73" | xref | delta_composition "O(3) S dHex Hex HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:28:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_795_mono_mass "794.226292" | xref | spec_1_neutral_loss_795_avge_mass "794.73" | xref | spec_1_neutral_loss_795_flag "false" | xref | spec_1_neutral_loss_795_composition "O(3) S dHex Hex HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_795_mono_mass "794.226292" | xref | spec_1_neutral_loss_795_avge_mass "794.73" | xref | spec_1_neutral_loss_795_flag "false" | xref | spec_1_neutral_loss_795_composition "O(3) S dHex Hex HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1588] === UNIMOD:1588 dHex(1)Hex(1)HexNAc(1)NeuAc(1) |
null .Term [UNIMOD:1588] [cols="2*"] |
| id | UNIMOD:1588 | name | dHex(1)Hex(1)HexNAc(1)NeuAc(1) | def | "DHex Hex HexNAc NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1588] | xref | record_id "1588" | xref | delta_mono_mass "802.285522" | xref | delta_avge_mass "802.7289" | xref | delta_composition "dHex(1) Hex(1) HexNAc(1) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_803_mono_mass "802.285522" | xref | spec_1_neutral_loss_803_avge_mass "802.7289" | xref | spec_1_neutral_loss_803_flag "false" | xref | spec_1_neutral_loss_803_composition "dHex(1) Hex(1) HexNAc(1) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_803_mono_mass "802.285522" | xref | spec_1_neutral_loss_803_avge_mass "802.7289" | xref | spec_1_neutral_loss_803_flag "false" | xref | spec_1_neutral_loss_803_composition "dHex(1) Hex(1) HexNAc(1) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1589] === UNIMOD:1589 Hex(2)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1589] [cols="2*"] |
| id | UNIMOD:1589 | name | Hex(2)HexNAc(2)Sulf(1) | def | "Hex(2) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1589] | xref | record_id "1589" | xref | delta_mono_mass "810.221207" | xref | delta_avge_mass "810.7294" | xref | delta_composition "O(3) S Hex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:28:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_811_mono_mass "810.221207" | xref | spec_1_neutral_loss_811_avge_mass "810.7294" | xref | spec_1_neutral_loss_811_flag "false" | xref | spec_1_neutral_loss_811_composition "O(3) S Hex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_811_mono_mass "810.221207" | xref | spec_1_neutral_loss_811_avge_mass "810.7294" | xref | spec_1_neutral_loss_811_flag "false" | xref | spec_1_neutral_loss_811_composition "O(3) S Hex(2) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1590] === UNIMOD:1590 Hex(5) |
null .Term [UNIMOD:1590] [cols="2*"] |
| id | UNIMOD:1590 | name | Hex(5) | def | "Hex(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1590] | xref | record_id "1590" | xref | delta_mono_mass "810.264117" | xref | delta_avge_mass "810.703" | xref | delta_composition "Hex(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_811_mono_mass "810.264117" | xref | spec_1_neutral_loss_811_avge_mass "810.703" | xref | spec_1_neutral_loss_811_flag "false" | xref | spec_1_neutral_loss_811_composition "Hex(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_811_mono_mass "810.264117" | xref | spec_1_neutral_loss_811_avge_mass "810.703" | xref | spec_1_neutral_loss_811_flag "false" | xref | spec_1_neutral_loss_811_composition "Hex(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1591] === UNIMOD:1591 HexNAc(4) |
null .Term [UNIMOD:1591] [cols="2*"] |
| id | UNIMOD:1591 | name | HexNAc(4) | def | "HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1591] | xref | record_id "1591" | xref | delta_mono_mass "812.31749" | xref | delta_avge_mass "812.7701" | xref | delta_composition "HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_813_mono_mass "812.31749" | xref | spec_1_neutral_loss_813_avge_mass "812.7701" | xref | spec_1_neutral_loss_813_flag "false" | xref | spec_1_neutral_loss_813_composition "HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_813_mono_mass "812.31749" | xref | spec_1_neutral_loss_813_avge_mass "812.7701" | xref | spec_1_neutral_loss_813_flag "false" | xref | spec_1_neutral_loss_813_composition "HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1592] === UNIMOD:1592 HexNAc(1)NeuGc(2) |
null .Term [UNIMOD:1592] [cols="2*"] |
| id | UNIMOD:1592 | name | HexNAc(1)NeuGc(2) | def | "HexNAc NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1592] | xref | record_id "1592" | xref | delta_mono_mass "817.260035" | xref | delta_avge_mass "817.7005" | xref | delta_composition "HexNAc(1) NeuGc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_818_mono_mass "817.260035" | xref | spec_1_neutral_loss_818_avge_mass "817.7005" | xref | spec_1_neutral_loss_818_flag "false" | xref | spec_1_neutral_loss_818_composition "HexNAc(1) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_818_mono_mass "817.260035" | xref | spec_1_neutral_loss_818_avge_mass "817.7005" | xref | spec_1_neutral_loss_818_flag "false" | xref | spec_1_neutral_loss_818_composition "HexNAc(1) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1593] === UNIMOD:1593 dHex(1)Hex(1)HexNAc(1)NeuGc(1) |
null .Term [UNIMOD:1593] [cols="2*"] |
| id | UNIMOD:1593 | name | dHex(1)Hex(1)HexNAc(1)NeuGc(1) | def | "DHex Hex HexNAc NeuGc ---OR--- Hex(2) HexNAc NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1593] | xref | record_id "1593" | xref | delta_mono_mass "818.280436" | xref | delta_avge_mass "818.7283" | xref | delta_composition "dHex Hex HexNAc NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 11:43:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_819_mono_mass "818.280436" | xref | spec_1_neutral_loss_819_avge_mass "818.7283" | xref | spec_1_neutral_loss_819_flag "false" | xref | spec_1_neutral_loss_819_composition "dHex Hex HexNAc NeuGc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_819_mono_mass "818.280436" | xref | spec_1_neutral_loss_819_avge_mass "818.7283" | xref | spec_1_neutral_loss_819_flag "false" | xref | spec_1_neutral_loss_819_composition "dHex Hex HexNAc NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1594] === UNIMOD:1594 dHex(2)Hex(2)HexNAc(1) |
null .Term [UNIMOD:1594] [cols="2*"] |
| id | UNIMOD:1594 | name | dHex(2)Hex(2)HexNAc(1) | def | "DHex(2) Hex(2) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1594] | xref | record_id "1594" | xref | delta_mono_mass "819.300837" | xref | delta_avge_mass "819.7561" | xref | delta_composition "dHex(2) Hex(2) HexNAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_820_mono_mass "819.300837" | xref | spec_1_neutral_loss_820_avge_mass "819.7561" | xref | spec_1_neutral_loss_820_flag "false" | xref | spec_1_neutral_loss_820_composition "dHex(2) Hex(2) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_820_mono_mass "819.300837" | xref | spec_1_neutral_loss_820_avge_mass "819.7561" | xref | spec_1_neutral_loss_820_flag "false" | xref | spec_1_neutral_loss_820_composition "dHex(2) Hex(2) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1595] === UNIMOD:1595 Hex(2)HexNAc(1)NeuGc(1) |
null .Term [UNIMOD:1595] [cols="2*"] |
| id | UNIMOD:1595 | name | Hex(2)HexNAc(1)NeuGc(1) | def | "Hex(2) HexNAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1595] | xref | record_id "1595" | xref | delta_mono_mass "834.275351" | xref | delta_avge_mass "834.7277" | xref | delta_composition "Hex(2) HexNAc(1) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_835_mono_mass "834.275351" | xref | spec_1_neutral_loss_835_avge_mass "834.7277" | xref | spec_1_neutral_loss_835_flag "false" | xref | spec_1_neutral_loss_835_composition "Hex(2) HexNAc(1) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_835_mono_mass "834.275351" | xref | spec_1_neutral_loss_835_avge_mass "834.7277" | xref | spec_1_neutral_loss_835_flag "false" | xref | spec_1_neutral_loss_835_composition "Hex(2) HexNAc(1) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1596] === UNIMOD:1596 dHex(1)Hex(3)HexNAc(1) |
null .Term [UNIMOD:1596] [cols="2*"] |
| id | UNIMOD:1596 | name | dHex(1)Hex(3)HexNAc(1) | def | "DHex Hex(3) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1596] | xref | record_id "1596" | xref | delta_mono_mass "835.295752" | xref | delta_avge_mass "835.7555" | xref | delta_composition "dHex(1) Hex(3) HexNAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_836_mono_mass "835.295752" | xref | spec_1_neutral_loss_836_avge_mass "835.7555" | xref | spec_1_neutral_loss_836_flag "false" | xref | spec_1_neutral_loss_836_composition "dHex(1) Hex(3) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_836_mono_mass "835.295752" | xref | spec_1_neutral_loss_836_avge_mass "835.7555" | xref | spec_1_neutral_loss_836_flag "false" | xref | spec_1_neutral_loss_836_composition "dHex(1) Hex(3) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1597] === UNIMOD:1597 dHex(1)Hex(2)HexA(1)HexNAc(1) |
null .Term [UNIMOD:1597] [cols="2*"] |
| id | UNIMOD:1597 | name | dHex(1)Hex(2)HexA(1)HexNAc(1) | def | "DHex Hex(2) HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1597] | xref | record_id "1597" | xref | delta_mono_mass "849.275017" | xref | delta_avge_mass "849.739" | xref | delta_composition "dHex(1) Hex(2) HexA(1) HexNAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_850_mono_mass "849.275017" | xref | spec_1_neutral_loss_850_avge_mass "849.739" | xref | spec_1_neutral_loss_850_flag "false" | xref | spec_1_neutral_loss_850_composition "dHex(1) Hex(2) HexA(1) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_850_mono_mass "849.275017" | xref | spec_1_neutral_loss_850_avge_mass "849.739" | xref | spec_1_neutral_loss_850_flag "false" | xref | spec_1_neutral_loss_850_composition "dHex(1) Hex(2) HexA(1) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1598] === UNIMOD:1598 Hex(1)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1598] [cols="2*"] |
| id | UNIMOD:1598 | name | Hex(1)HexNAc(3)Sulf(1) | def | "Hex HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1598] | xref | record_id "1598" | xref | delta_mono_mass "851.247756" | xref | delta_avge_mass "851.7814" | xref | delta_composition "O(3) S Hex HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:28:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_852_mono_mass "851.247756" | xref | spec_1_neutral_loss_852_avge_mass "851.7814" | xref | spec_1_neutral_loss_852_flag "false" | xref | spec_1_neutral_loss_852_composition "O(3) S Hex HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_852_mono_mass "851.247756" | xref | spec_1_neutral_loss_852_avge_mass "851.7814" | xref | spec_1_neutral_loss_852_flag "false" | xref | spec_1_neutral_loss_852_composition "O(3) S Hex HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1599] === UNIMOD:1599 Hex(4)HexNAc(1) |
null .Term [UNIMOD:1599] [cols="2*"] |
| id | UNIMOD:1599 | name | Hex(4)HexNAc(1) | def | "Hex(4) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1599] | xref | record_id "1599" | xref | delta_mono_mass "851.290667" | xref | delta_avge_mass "851.7549" | xref | delta_composition "Hex(4) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-24 10:39:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_852_mono_mass "851.290667" | xref | spec_1_neutral_loss_852_avge_mass "851.7549" | xref | spec_1_neutral_loss_852_flag "false" | xref | spec_1_neutral_loss_852_composition "Hex(4) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_852_mono_mass "851.290667" | xref | spec_1_neutral_loss_852_avge_mass "851.7549" | xref | spec_1_neutral_loss_852_flag "false" | xref | spec_1_neutral_loss_852_composition "Hex(4) HexNAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_852_mono_mass "851.290667" | xref | spec_2_neutral_loss_852_avge_mass "851.7549" | xref | spec_2_neutral_loss_852_flag "false" | xref | spec_2_neutral_loss_852_composition "Hex(4) HexNAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1600] === UNIMOD:1600 Hex(1)HexNAc(2)NeuAc(1) |
null .Term [UNIMOD:1600] [cols="2*"] |
| id | UNIMOD:1600 | name | Hex(1)HexNAc(2)NeuAc(1) | def | "Hex HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1600] | xref | record_id "1600" | xref | delta_mono_mass "859.306985" | xref | delta_avge_mass "859.7802" | xref | delta_composition "Hex(1) HexNAc(2) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_860_mono_mass "859.306985" | xref | spec_1_neutral_loss_860_avge_mass "859.7802" | xref | spec_1_neutral_loss_860_flag "false" | xref | spec_1_neutral_loss_860_composition "Hex(1) HexNAc(2) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_860_mono_mass "859.306985" | xref | spec_1_neutral_loss_860_avge_mass "859.7802" | xref | spec_1_neutral_loss_860_flag "false" | xref | spec_1_neutral_loss_860_composition "Hex(1) HexNAc(2) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1602] === UNIMOD:1602 Hex(1)HexNAc(2)NeuGc(1) |
null .Term [UNIMOD:1602] [cols="2*"] |
| id | UNIMOD:1602 | name | Hex(1)HexNAc(2)NeuGc(1) | def | "Hex HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1602] | xref | record_id "1602" | xref | delta_mono_mass "875.3019" | xref | delta_avge_mass "875.7796" | xref | delta_composition "Hex(1) HexNAc(2) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_876_mono_mass "875.3019" | xref | spec_1_neutral_loss_876_avge_mass "875.7796" | xref | spec_1_neutral_loss_876_flag "false" | xref | spec_1_neutral_loss_876_composition "Hex(1) HexNAc(2) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_876_mono_mass "875.3019" | xref | spec_1_neutral_loss_876_avge_mass "875.7796" | xref | spec_1_neutral_loss_876_flag "false" | xref | spec_1_neutral_loss_876_composition "Hex(1) HexNAc(2) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1604] === UNIMOD:1604 Hex(5)Phos(1) |
null .Term [UNIMOD:1604] [cols="2*"] |
| id | UNIMOD:1604 | name | Hex(5)Phos(1) | def | "Hex(5) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1604] | xref | record_id "1604" | xref | delta_mono_mass "890.230448" | xref | delta_avge_mass "890.6829" | xref | delta_composition "H O(3) P Hex(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:42:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_891_mono_mass "890.230448" | xref | spec_1_neutral_loss_891_avge_mass "890.6829" | xref | spec_1_neutral_loss_891_flag "false" | xref | spec_1_neutral_loss_891_composition "H O(3) P Hex(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_891_mono_mass "890.230448" | xref | spec_1_neutral_loss_891_avge_mass "890.6829" | xref | spec_1_neutral_loss_891_flag "false" | xref | spec_1_neutral_loss_891_composition "H O(3) P Hex(5)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1606] === UNIMOD:1606 dHex(2)Hex(1)HexNAc(1)Kdn(1) |
null .Term [UNIMOD:1606] [cols="2*"] |
| id | UNIMOD:1606 | name | dHex(2)Hex(1)HexNAc(1)Kdn(1) | def | "DHex(2) Hex HexNAc Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=1&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1606] | xref | record_id "1606" | xref | delta_mono_mass "907.316881" | xref | delta_avge_mass "907.8182" | xref | delta_composition "dHex(2) Hex HexNAc Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:57:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_908_mono_mass "907.316881" | xref | spec_1_neutral_loss_908_avge_mass "907.8182" | xref | spec_1_neutral_loss_908_flag "false" | xref | spec_1_neutral_loss_908_composition "dHex(2) Hex HexNAc Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_908_mono_mass "907.316881" | xref | spec_1_neutral_loss_908_avge_mass "907.8182" | xref | spec_1_neutral_loss_908_flag "false" | xref | spec_1_neutral_loss_908_composition "dHex(2) Hex HexNAc Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1607] === UNIMOD:1607 dHex(1)Hex(3)HexNAc(1)Sulf(1) |
null .Term [UNIMOD:1607] [cols="2*"] |
| id | UNIMOD:1607 | name | dHex(1)Hex(3)HexNAc(1)Sulf(1) | def | "DHex Hex(3) HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1607] | xref | record_id "1607" | xref | delta_mono_mass "915.252567" | xref | delta_avge_mass "915.8187" | xref | delta_composition "O(3) S dHex Hex(3) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:28:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_916_mono_mass "915.252567" | xref | spec_1_neutral_loss_916_avge_mass "915.8187" | xref | spec_1_neutral_loss_916_flag "false" | xref | spec_1_neutral_loss_916_composition "O(3) S dHex Hex(3) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_916_mono_mass "915.252567" | xref | spec_1_neutral_loss_916_avge_mass "915.8187" | xref | spec_1_neutral_loss_916_flag "false" | xref | spec_1_neutral_loss_916_composition "O(3) S dHex Hex(3) HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1608] === UNIMOD:1608 dHex(1)Hex(1)HexNAc(3) |
null .Term [UNIMOD:1608] [cols="2*"] |
| id | UNIMOD:1608 | name | dHex(1)Hex(1)HexNAc(3) | def | "DHex Hex HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1608] | xref | record_id "1608" | xref | delta_mono_mass "917.34885" | xref | delta_avge_mass "917.8594" | xref | delta_composition "dHex(1) Hex(1) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_918_mono_mass "917.34885" | xref | spec_1_neutral_loss_918_avge_mass "917.8594" | xref | spec_1_neutral_loss_918_flag "false" | xref | spec_1_neutral_loss_918_composition "dHex(1) Hex(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_918_mono_mass "917.34885" | xref | spec_1_neutral_loss_918_avge_mass "917.8594" | xref | spec_1_neutral_loss_918_flag "false" | xref | spec_1_neutral_loss_918_composition "dHex(1) Hex(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1609] === UNIMOD:1609 dHex(1)Hex(2)HexA(1)HexNAc(1)Sulf(1) |
null .Term [UNIMOD:1609] [cols="2*"] |
| id | UNIMOD:1609 | name | dHex(1)Hex(2)HexA(1)HexNAc(1)Sulf(1) | def | "DHex Hex(2) HexA HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1609] | xref | record_id "1609" | xref | delta_mono_mass "929.231831" | xref | delta_avge_mass "929.8022" | xref | delta_composition "O(3) S dHex Hex(2) HexA HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:28:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_930_mono_mass "929.231831" | xref | spec_1_neutral_loss_930_avge_mass "929.8022" | xref | spec_1_neutral_loss_930_flag "false" | xref | spec_1_neutral_loss_930_composition "O(3) S dHex Hex(2) HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_930_mono_mass "929.231831" | xref | spec_1_neutral_loss_930_avge_mass "929.8022" | xref | spec_1_neutral_loss_930_flag "false" | xref | spec_1_neutral_loss_930_composition "O(3) S dHex Hex(2) HexA HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1610] === UNIMOD:1610 Hex(2)HexNAc(3) |
null .Term [UNIMOD:1610] [cols="2*"] |
| id | UNIMOD:1610 | name | Hex(2)HexNAc(3) | def | "Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1610] | xref | record_id "1610" | xref | delta_mono_mass "933.343765" | xref | delta_avge_mass "933.8588" | xref | delta_composition "Hex(2) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-24 10:43:39" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_934_mono_mass "933.343765" | xref | spec_1_neutral_loss_934_avge_mass "933.8588" | xref | spec_1_neutral_loss_934_flag "false" | xref | spec_1_neutral_loss_934_composition "Hex(2) HexNAc(3)" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_934_mono_mass "933.343765" | xref | spec_1_neutral_loss_934_avge_mass "933.8588" | xref | spec_1_neutral_loss_934_flag "false" | xref | spec_1_neutral_loss_934_composition "Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_934_mono_mass "933.343765" | xref | spec_2_neutral_loss_934_avge_mass "933.8588" | xref | spec_2_neutral_loss_934_flag "false" | xref | spec_2_neutral_loss_934_composition "Hex(2) HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1611] === UNIMOD:1611 Hex(1)HexNAc(2)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1611] [cols="2*"] |
| id | UNIMOD:1611 | name | Hex(1)HexNAc(2)NeuAc(1)Sulf(1) | def | "Hex HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1611] | xref | record_id "1611" | xref | delta_mono_mass "939.2638" | xref | delta_avge_mass "939.8434" | xref | delta_composition "O(3) S Hex HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:29:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_940_mono_mass "939.2638" | xref | spec_1_neutral_loss_940_avge_mass "939.8434" | xref | spec_1_neutral_loss_940_flag "false" | xref | spec_1_neutral_loss_940_composition "O(3) S Hex HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_940_mono_mass "939.2638" | xref | spec_1_neutral_loss_940_avge_mass "939.8434" | xref | spec_1_neutral_loss_940_flag "false" | xref | spec_1_neutral_loss_940_composition "O(3) S Hex HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1612] === UNIMOD:1612 dHex(2)Hex(4) |
null .Term [UNIMOD:1612] [cols="2*"] |
| id | UNIMOD:1612 | name | dHex(2)Hex(4) | def | "DHex(2) Hex(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1612] | xref | record_id "1612" | xref | delta_mono_mass "940.327112" | xref | delta_avge_mass "940.8448" | xref | delta_composition "dHex(2) Hex(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_941_mono_mass "940.327112" | xref | spec_1_neutral_loss_941_avge_mass "940.8448" | xref | spec_1_neutral_loss_941_flag "false" | xref | spec_1_neutral_loss_941_composition "dHex(2) Hex(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_941_mono_mass "940.327112" | xref | spec_1_neutral_loss_941_avge_mass "940.8448" | xref | spec_1_neutral_loss_941_flag "false" | xref | spec_1_neutral_loss_941_composition "dHex(2) Hex(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1614] === UNIMOD:1614 dHex(2)HexNAc(2)Kdn(1) |
null .Term [UNIMOD:1614] [cols="2*"] |
| id | UNIMOD:1614 | name | dHex(2)HexNAc(2)Kdn(1) | def | "DHex(2) HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1614] | xref | record_id "1614" | xref | delta_mono_mass "948.34343" | xref | delta_avge_mass "948.8701" | xref | delta_composition "dHex(2) HexNAc(2) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:57:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_949_mono_mass "948.34343" | xref | spec_1_neutral_loss_949_avge_mass "948.8701" | xref | spec_1_neutral_loss_949_flag "false" | xref | spec_1_neutral_loss_949_composition "dHex(2) HexNAc(2) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_949_mono_mass "948.34343" | xref | spec_1_neutral_loss_949_avge_mass "948.8701" | xref | spec_1_neutral_loss_949_flag "false" | xref | spec_1_neutral_loss_949_composition "dHex(2) HexNAc(2) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1615] === UNIMOD:1615 dHex(1)Hex(2)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1615] [cols="2*"] |
| id | UNIMOD:1615 | name | dHex(1)Hex(2)HexNAc(2)Sulf(1) | def | "DHex Hex(2) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1615] | xref | record_id "1615" | xref | delta_mono_mass "956.279116" | xref | delta_avge_mass "956.8706" | xref | delta_composition "O(3) S dHex Hex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:29:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_957_mono_mass "956.279116" | xref | spec_1_neutral_loss_957_avge_mass "956.8706" | xref | spec_1_neutral_loss_957_flag "false" | xref | spec_1_neutral_loss_957_composition "O(3) S dHex Hex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_957_mono_mass "956.279116" | xref | spec_1_neutral_loss_957_avge_mass "956.8706" | xref | spec_1_neutral_loss_957_flag "false" | xref | spec_1_neutral_loss_957_composition "O(3) S dHex Hex(2) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1616] === UNIMOD:1616 dHex(1)HexNAc(4) |
null .Term [UNIMOD:1616] [cols="2*"] |
| id | UNIMOD:1616 | name | dHex(1)HexNAc(4) | def | "DHex HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1616] | xref | record_id "1616" | xref | delta_mono_mass "958.375399" | xref | delta_avge_mass "958.9113" | xref | delta_composition "dHex(1) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_959_mono_mass "958.375399" | xref | spec_1_neutral_loss_959_avge_mass "958.9113" | xref | spec_1_neutral_loss_959_flag "false" | xref | spec_1_neutral_loss_959_composition "dHex(1) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_959_mono_mass "958.375399" | xref | spec_1_neutral_loss_959_avge_mass "958.9113" | xref | spec_1_neutral_loss_959_flag "false" | xref | spec_1_neutral_loss_959_composition "dHex(1) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1617] === UNIMOD:1617 Hex(1)HexNAc(1)NeuAc(1)NeuGc(1) |
null .Term [UNIMOD:1617] [cols="2*"] |
| id | UNIMOD:1617 | name | Hex(1)HexNAc(1)NeuAc(1)NeuGc(1) | def | "Hex HexNAc NeuAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neuac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1617] | xref | record_id "1617" | xref | delta_mono_mass "963.317944" | xref | delta_avge_mass "963.8417" | xref | delta_composition "Hex(1) HexNAc(1) NeuAc(1) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_964_mono_mass "963.317944" | xref | spec_1_neutral_loss_964_avge_mass "963.8417" | xref | spec_1_neutral_loss_964_flag "false" | xref | spec_1_neutral_loss_964_composition "Hex(1) HexNAc(1) NeuAc(1) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_964_mono_mass "963.317944" | xref | spec_1_neutral_loss_964_avge_mass "963.8417" | xref | spec_1_neutral_loss_964_flag "false" | xref | spec_1_neutral_loss_964_composition "Hex(1) HexNAc(1) NeuAc(1) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1618] === UNIMOD:1618 dHex(1)Hex(1)HexNAc(2)Kdn(1) |
null .Term [UNIMOD:1618] [cols="2*"] |
| id | UNIMOD:1618 | name | dHex(1)Hex(1)HexNAc(2)Kdn(1) | def | "DHex Hex HexNAc(2) Kdn ---OR--- Hex(2) HexNAc dHex NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1618] | xref | record_id "1618" | xref | delta_mono_mass "964.338345" | xref | delta_avge_mass "964.8695" | xref | delta_composition "dHex Hex HexNAc(2) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 11:43:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_965_mono_mass "964.338345" | xref | spec_1_neutral_loss_965_avge_mass "964.8695" | xref | spec_1_neutral_loss_965_flag "false" | xref | spec_1_neutral_loss_965_composition "dHex Hex HexNAc(2) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_965_mono_mass "964.338345" | xref | spec_1_neutral_loss_965_avge_mass "964.8695" | xref | spec_1_neutral_loss_965_flag "false" | xref | spec_1_neutral_loss_965_composition "dHex Hex HexNAc(2) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1619] === UNIMOD:1619 Hex(1)HexNAc(1)NeuGc(2) |
null .Term [UNIMOD:1619] [cols="2*"] |
| id | UNIMOD:1619 | name | Hex(1)HexNAc(1)NeuGc(2) | def | "Hex HexNAc NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1619] | xref | record_id "1619" | xref | delta_mono_mass "979.312859" | xref | delta_avge_mass "979.8411" | xref | delta_composition "Hex(1) HexNAc(1) NeuGc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_980_mono_mass "979.312859" | xref | spec_1_neutral_loss_980_avge_mass "979.8411" | xref | spec_1_neutral_loss_980_flag "false" | xref | spec_1_neutral_loss_980_composition "Hex(1) HexNAc(1) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_980_mono_mass "979.312859" | xref | spec_1_neutral_loss_980_avge_mass "979.8411" | xref | spec_1_neutral_loss_980_flag "false" | xref | spec_1_neutral_loss_980_composition "Hex(1) HexNAc(1) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1620] === UNIMOD:1620 Hex(1)HexNAc(1)NeuAc(2)Ac(1) |
null .Term [UNIMOD:1620] [cols="2*"] |
| id | UNIMOD:1620 | name | Hex(1)HexNAc(1)NeuAc(2)Ac(1) | def | "Ac Hex HexNAc NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=1&hex=1&hexnac=1&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1620] | xref | record_id "1620" | xref | delta_mono_mass "989.333594" | xref | delta_avge_mass "989.879" | xref | delta_composition "Ac Hex HexNAc NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:37:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_990_mono_mass "989.333594" | xref | spec_1_neutral_loss_990_avge_mass "989.879" | xref | spec_1_neutral_loss_990_flag "false" | xref | spec_1_neutral_loss_990_composition "Ac Hex HexNAc NeuAc(2)" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_990_mono_mass "989.333594" | xref | spec_1_neutral_loss_990_avge_mass "989.879" | xref | spec_1_neutral_loss_990_flag "false" | xref | spec_1_neutral_loss_990_composition "Ac Hex HexNAc NeuAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1621] === UNIMOD:1621 dHex(2)Hex(2)HexA(1)HexNAc(1) |
null .Term [UNIMOD:1621] [cols="2*"] |
| id | UNIMOD:1621 | name | dHex(2)Hex(2)HexA(1)HexNAc(1) | def | "DHex(2) Hex(2) HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1621] | xref | record_id "1621" | xref | delta_mono_mass "995.332925" | xref | delta_avge_mass "995.8802" | xref | delta_composition "dHex(2) Hex(2) HexA(1) HexNAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_996_mono_mass "995.332925" | xref | spec_1_neutral_loss_996_avge_mass "995.8802" | xref | spec_1_neutral_loss_996_flag "false" | xref | spec_1_neutral_loss_996_composition "dHex(2) Hex(2) HexA(1) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_996_mono_mass "995.332925" | xref | spec_1_neutral_loss_996_avge_mass "995.8802" | xref | spec_1_neutral_loss_996_flag "false" | xref | spec_1_neutral_loss_996_composition "dHex(2) Hex(2) HexA(1) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1622] === UNIMOD:1622 dHex(1)Hex(1)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1622] [cols="2*"] |
| id | UNIMOD:1622 | name | dHex(1)Hex(1)HexNAc(3)Sulf(1) | def | "DHex Hex HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1622] | xref | record_id "1622" | xref | delta_mono_mass "997.305665" | xref | delta_avge_mass "997.9226" | xref | delta_composition "O(3) S dHex Hex HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:29:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_998_mono_mass "997.305665" | xref | spec_1_neutral_loss_998_avge_mass "997.9226" | xref | spec_1_neutral_loss_998_flag "false" | xref | spec_1_neutral_loss_998_composition "O(3) S dHex Hex HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_998_mono_mass "997.305665" | xref | spec_1_neutral_loss_998_avge_mass "997.9226" | xref | spec_1_neutral_loss_998_flag "false" | xref | spec_1_neutral_loss_998_composition "O(3) S dHex Hex HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1623] === UNIMOD:1623 Hex(2)HexA(1)NeuAc(1)Pent(1)Sulf(1) |
null .Term [UNIMOD:1623] [cols="2*"] |
| id | UNIMOD:1623 | name | Hex(2)HexA(1)NeuAc(1)Pent(1)Sulf(1) | def | "Hex(2) HexA NeuAc Pent Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&pent=1&hex=2&hexa=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1623] | xref | record_id "1623" | xref | delta_mono_mass "1003.232225" | xref | delta_avge_mass "1003.8377" | xref | delta_composition "O(3) S Pent Hex(2) HexA NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:29:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1004_mono_mass "1003.232225" | xref | spec_1_neutral_loss_1004_avge_mass "1003.8377" | xref | spec_1_neutral_loss_1004_flag "false" | xref | spec_1_neutral_loss_1004_composition "O(3) S Pent Hex(2) HexA NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1004_mono_mass "1003.232225" | xref | spec_1_neutral_loss_1004_avge_mass "1003.8377" | xref | spec_1_neutral_loss_1004_flag "false" | xref | spec_1_neutral_loss_1004_composition "O(3) S Pent Hex(2) HexA NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1624] === UNIMOD:1624 dHex(1)Hex(1)HexNAc(2)NeuAc(1) |
null .Term [UNIMOD:1624] [cols="2*"] |
| id | UNIMOD:1624 | name | dHex(1)Hex(1)HexNAc(2)NeuAc(1) | def | "DHex Hex HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1624] | xref | record_id "1624" | xref | delta_mono_mass "1005.364894" | xref | delta_avge_mass "1005.9214" | xref | delta_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1006_mono_mass "1005.364894" | xref | spec_1_neutral_loss_1006_avge_mass "1005.9214" | xref | spec_1_neutral_loss_1006_flag "false" | xref | spec_1_neutral_loss_1006_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1006_mono_mass "1005.364894" | xref | spec_1_neutral_loss_1006_avge_mass "1005.9214" | xref | spec_1_neutral_loss_1006_flag "false" | xref | spec_1_neutral_loss_1006_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1625] === UNIMOD:1625 dHex(1)Hex(3)HexA(1)HexNAc(1) |
null .Term [UNIMOD:1625] [cols="2*"] |
| id | UNIMOD:1625 | name | dHex(1)Hex(3)HexA(1)HexNAc(1) | def | "DHex Hex(3) HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1625] | xref | record_id "1625" | xref | delta_mono_mass "1011.32784" | xref | delta_avge_mass "1011.8796" | xref | delta_composition "dHex(1) Hex(3) HexA(1) HexNAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1012_mono_mass "1011.32784" | xref | spec_1_neutral_loss_1012_avge_mass "1011.8796" | xref | spec_1_neutral_loss_1012_flag "false" | xref | spec_1_neutral_loss_1012_composition "dHex(1) Hex(3) HexA(1) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1012_mono_mass "1011.32784" | xref | spec_1_neutral_loss_1012_avge_mass "1011.8796" | xref | spec_1_neutral_loss_1012_flag "false" | xref | spec_1_neutral_loss_1012_composition "dHex(1) Hex(3) HexA(1) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1626] === UNIMOD:1626 Hex(2)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1626] [cols="2*"] |
| id | UNIMOD:1626 | name | Hex(2)HexNAc(3)Sulf(1) | def | "Hex(2) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1626] | xref | record_id "1626" | xref | delta_mono_mass "1013.300579" | xref | delta_avge_mass "1013.922" | xref | delta_composition "O(3) S Hex(2) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:30:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1014_mono_mass "1013.300579" | xref | spec_1_neutral_loss_1014_avge_mass "1013.922" | xref | spec_1_neutral_loss_1014_flag "false" | xref | spec_1_neutral_loss_1014_composition "O(3) S Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1014_mono_mass "1013.300579" | xref | spec_1_neutral_loss_1014_avge_mass "1013.922" | xref | spec_1_neutral_loss_1014_flag "false" | xref | spec_1_neutral_loss_1014_composition "O(3) S Hex(2) HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1627] === UNIMOD:1627 Hex(5)HexNAc(1) |
null .Term [UNIMOD:1627] [cols="2*"] |
| id | UNIMOD:1627 | name | Hex(5)HexNAc(1) | def | "Hex(5) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1627] | xref | record_id "1627" | xref | delta_mono_mass "1013.34349" | xref | delta_avge_mass "1013.8955" | xref | delta_composition "Hex(5) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-24 11:00:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1014_mono_mass "1013.34349" | xref | spec_1_neutral_loss_1014_avge_mass "1013.8955" | xref | spec_1_neutral_loss_1014_flag "false" | xref | spec_1_neutral_loss_1014_composition "Hex(5) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1014_mono_mass "1013.34349" | xref | spec_1_neutral_loss_1014_avge_mass "1013.8955" | xref | spec_1_neutral_loss_1014_flag "false" | xref | spec_1_neutral_loss_1014_composition "Hex(5) HexNAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1014_mono_mass "1013.34349" | xref | spec_2_neutral_loss_1014_avge_mass "1013.8955" | xref | spec_2_neutral_loss_1014_flag "false" | xref | spec_2_neutral_loss_1014_composition "Hex(5) HexNAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1628] === UNIMOD:1628 HexNAc(5) |
null .Term [UNIMOD:1628] [cols="2*"] |
| id | UNIMOD:1628 | name | HexNAc(5) | def | "HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1628] | xref | record_id "1628" | xref | delta_mono_mass "1015.396863" | xref | delta_avge_mass "1015.9626" | xref | delta_composition "HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1016_mono_mass "1015.396863" | xref | spec_1_neutral_loss_1016_avge_mass "1015.9626" | xref | spec_1_neutral_loss_1016_flag "false" | xref | spec_1_neutral_loss_1016_composition "HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1016_mono_mass "1015.396863" | xref | spec_1_neutral_loss_1016_avge_mass "1015.9626" | xref | spec_1_neutral_loss_1016_flag "false" | xref | spec_1_neutral_loss_1016_composition "HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1630] === UNIMOD:1630 Hex(1)HexNAc(1)NeuAc(2)Ac(2) |
null .Term [UNIMOD:1630] [cols="2*"] |
| id | UNIMOD:1630 | name | Hex(1)HexNAc(1)NeuAc(2)Ac(2) | def | "Ac(2) Hex HexNAc NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=2&hex=1&hexnac=1&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1630] | xref | record_id "1630" | xref | delta_mono_mass "1031.344159" | xref | delta_avge_mass "1031.9156" | xref | delta_composition "Ac(2) Hex HexNAc NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:38:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1032_mono_mass "1031.344159" | xref | spec_1_neutral_loss_1032_avge_mass "1031.9156" | xref | spec_1_neutral_loss_1032_flag "false" | xref | spec_1_neutral_loss_1032_composition "Ac(2) Hex HexNAc NeuAc(2)" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1032_mono_mass "1031.344159" | xref | spec_1_neutral_loss_1032_avge_mass "1031.9156" | xref | spec_1_neutral_loss_1032_flag "false" | xref | spec_1_neutral_loss_1032_composition "Ac(2) Hex HexNAc NeuAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1631] === UNIMOD:1631 Hex(2)HexNAc(2)NeuGc(1) |
null .Term [UNIMOD:1631] [cols="2*"] |
| id | UNIMOD:1631 | name | Hex(2)HexNAc(2)NeuGc(1) | def | "Hex(2) HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1631] | xref | record_id "1631" | xref | delta_mono_mass "1037.354723" | xref | delta_avge_mass "1037.9202" | xref | delta_composition "Hex(2) HexNAc(2) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1038_mono_mass "1037.354723" | xref | spec_1_neutral_loss_1038_avge_mass "1037.9202" | xref | spec_1_neutral_loss_1038_flag "false" | xref | spec_1_neutral_loss_1038_composition "Hex(2) HexNAc(2) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1038_mono_mass "1037.354723" | xref | spec_1_neutral_loss_1038_avge_mass "1037.9202" | xref | spec_1_neutral_loss_1038_flag "false" | xref | spec_1_neutral_loss_1038_composition "Hex(2) HexNAc(2) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1632] === UNIMOD:1632 Hex(5)Phos(3) |
null .Term [UNIMOD:1632] [cols="2*"] |
| id | UNIMOD:1632 | name | Hex(5)Phos(3) | def | "Hex(5) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1632] | xref | record_id "1632" | xref | delta_mono_mass "1050.16311" | xref | delta_avge_mass "1050.6427" | xref | delta_composition "H(3) O(9) P(3) Hex(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:42:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1051_mono_mass "1050.16311" | xref | spec_1_neutral_loss_1051_avge_mass "1050.6427" | xref | spec_1_neutral_loss_1051_flag "false" | xref | spec_1_neutral_loss_1051_composition "H(3) O(9) P(3) Hex(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1051_mono_mass "1050.16311" | xref | spec_1_neutral_loss_1051_avge_mass "1050.6427" | xref | spec_1_neutral_loss_1051_flag "false" | xref | spec_1_neutral_loss_1051_composition "H(3) O(9) P(3) Hex(5)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1633] === UNIMOD:1633 Hex(6)Phos(1) |
null .Term [UNIMOD:1633] [cols="2*"] |
| id | UNIMOD:1633 | name | Hex(6)Phos(1) | def | "Hex(6) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1633] | xref | record_id "1633" | xref | delta_mono_mass "1052.283272" | xref | delta_avge_mass "1052.8235" | xref | delta_composition "H O(3) P Hex(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:42:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1053_mono_mass "1052.283272" | xref | spec_1_neutral_loss_1053_avge_mass "1052.8235" | xref | spec_1_neutral_loss_1053_flag "false" | xref | spec_1_neutral_loss_1053_composition "H O(3) P Hex(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1053_mono_mass "1052.283272" | xref | spec_1_neutral_loss_1053_avge_mass "1052.8235" | xref | spec_1_neutral_loss_1053_flag "false" | xref | spec_1_neutral_loss_1053_composition "H O(3) P Hex(6)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1634] === UNIMOD:1634 dHex(1)Hex(2)HexA(1)HexNAc(2) |
null .Term [UNIMOD:1634] [cols="2*"] |
| id | UNIMOD:1634 | name | dHex(1)Hex(2)HexA(1)HexNAc(2) | def | "DHex Hex(2) HexA HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1634] | xref | record_id "1634" | xref | delta_mono_mass "1052.354389" | xref | delta_avge_mass "1052.9316" | xref | delta_composition "dHex(1) Hex(2) HexA(1) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1053_mono_mass "1052.354389" | xref | spec_1_neutral_loss_1053_avge_mass "1052.9316" | xref | spec_1_neutral_loss_1053_flag "false" | xref | spec_1_neutral_loss_1053_composition "dHex(1) Hex(2) HexA(1) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1053_mono_mass "1052.354389" | xref | spec_1_neutral_loss_1053_avge_mass "1052.9316" | xref | spec_1_neutral_loss_1053_flag "false" | xref | spec_1_neutral_loss_1053_composition "dHex(1) Hex(2) HexA(1) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1635] === UNIMOD:1635 dHex(2)Hex(3)HexNAc(1)Sulf(1) |
null .Term [UNIMOD:1635] [cols="2*"] |
| id | UNIMOD:1635 | name | dHex(2)Hex(3)HexNAc(1)Sulf(1) | def | "DHex(2) Hex(3) HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1635] | xref | record_id "1635" | xref | delta_mono_mass "1061.310475" | xref | delta_avge_mass "1061.9599" | xref | delta_composition "O(3) S dHex(2) Hex(3) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:30:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1062_mono_mass "1061.310475" | xref | spec_1_neutral_loss_1062_avge_mass "1061.9599" | xref | spec_1_neutral_loss_1062_flag "false" | xref | spec_1_neutral_loss_1062_composition "O(3) S dHex(2) Hex(3) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1062_mono_mass "1061.310475" | xref | spec_1_neutral_loss_1062_avge_mass "1061.9599" | xref | spec_1_neutral_loss_1062_flag "false" | xref | spec_1_neutral_loss_1062_composition "O(3) S dHex(2) Hex(3) HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1636] === UNIMOD:1636 Hex(1)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1636] [cols="2*"] |
| id | UNIMOD:1636 | name | Hex(1)HexNAc(3)NeuAc(1) | def | "Hex HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1636] | xref | record_id "1636" | xref | delta_mono_mass "1062.386358" | xref | delta_avge_mass "1062.9727" | xref | delta_composition "Hex(1) HexNAc(3) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1063_mono_mass "1062.386358" | xref | spec_1_neutral_loss_1063_avge_mass "1062.9727" | xref | spec_1_neutral_loss_1063_flag "false" | xref | spec_1_neutral_loss_1063_composition "Hex(1) HexNAc(3) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1063_mono_mass "1062.386358" | xref | spec_1_neutral_loss_1063_avge_mass "1062.9727" | xref | spec_1_neutral_loss_1063_flag "false" | xref | spec_1_neutral_loss_1063_composition "Hex(1) HexNAc(3) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1637] === UNIMOD:1637 dHex(2)Hex(1)HexNAc(3) |
null .Term [UNIMOD:1637] [cols="2*"] |
| id | UNIMOD:1637 | name | dHex(2)Hex(1)HexNAc(3) | def | "DHex(2) Hex HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1637] | xref | record_id "1637" | xref | delta_mono_mass "1063.406759" | xref | delta_avge_mass "1064.0006" | xref | delta_composition "dHex(2) Hex(1) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1064_mono_mass "1063.406759" | xref | spec_1_neutral_loss_1064_avge_mass "1064.0006" | xref | spec_1_neutral_loss_1064_flag "false" | xref | spec_1_neutral_loss_1064_composition "dHex(2) Hex(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1064_mono_mass "1063.406759" | xref | spec_1_neutral_loss_1064_avge_mass "1064.0006" | xref | spec_1_neutral_loss_1064_flag "false" | xref | spec_1_neutral_loss_1064_composition "dHex(2) Hex(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1638] === UNIMOD:1638 Hex(1)HexNAc(3)NeuGc(1) |
null .Term [UNIMOD:1638] [cols="2*"] |
| id | UNIMOD:1638 | name | Hex(1)HexNAc(3)NeuGc(1) | def | "Hex HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1638] | xref | record_id "1638" | xref | delta_mono_mass "1078.381273" | xref | delta_avge_mass "1078.9721" | xref | delta_composition "Hex(1) HexNAc(3) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1079_mono_mass "1078.381273" | xref | spec_1_neutral_loss_1079_avge_mass "1078.9721" | xref | spec_1_neutral_loss_1079_flag "false" | xref | spec_1_neutral_loss_1079_composition "Hex(1) HexNAc(3) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1079_mono_mass "1078.381273" | xref | spec_1_neutral_loss_1079_avge_mass "1078.9721" | xref | spec_1_neutral_loss_1079_flag "false" | xref | spec_1_neutral_loss_1079_composition "Hex(1) HexNAc(3) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1639] === UNIMOD:1639 dHex(1)Hex(1)HexNAc(2)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1639] [cols="2*"] |
| id | UNIMOD:1639 | name | dHex(1)Hex(1)HexNAc(2)NeuAc(1)Sulf(1) | def | "DHex Hex HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1639] | xref | record_id "1639" | xref | delta_mono_mass "1085.321709" | xref | delta_avge_mass "1085.9846" | xref | delta_composition "O(3) S dHex Hex HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:30:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1086_mono_mass "1085.321709" | xref | spec_1_neutral_loss_1086_avge_mass "1085.9846" | xref | spec_1_neutral_loss_1086_flag "false" | xref | spec_1_neutral_loss_1086_composition "O(3) S dHex Hex HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1086_mono_mass "1085.321709" | xref | spec_1_neutral_loss_1086_avge_mass "1085.9846" | xref | spec_1_neutral_loss_1086_flag "false" | xref | spec_1_neutral_loss_1086_composition "O(3) S dHex Hex HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1640] === UNIMOD:1640 dHex(1)Hex(3)HexA(1)HexNAc(1)Sulf(1) |
null .Term [UNIMOD:1640] [cols="2*"] |
| id | UNIMOD:1640 | name | dHex(1)Hex(3)HexA(1)HexNAc(1)Sulf(1) | def | "DHex Hex(3) HexA HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1640] | xref | record_id "1640" | xref | delta_mono_mass "1091.284655" | xref | delta_avge_mass "1091.9428" | xref | delta_composition "O(3) S dHex Hex(3) HexA HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:30:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1092_mono_mass "1091.284655" | xref | spec_1_neutral_loss_1092_avge_mass "1091.9428" | xref | spec_1_neutral_loss_1092_flag "false" | xref | spec_1_neutral_loss_1092_composition "O(3) S dHex Hex(3) HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1092_mono_mass "1091.284655" | xref | spec_1_neutral_loss_1092_avge_mass "1091.9428" | xref | spec_1_neutral_loss_1092_flag "false" | xref | spec_1_neutral_loss_1092_composition "O(3) S dHex Hex(3) HexA HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1641] === UNIMOD:1641 dHex(1)Hex(1)HexA(1)HexNAc(3) |
null .Term [UNIMOD:1641] [cols="2*"] |
| id | UNIMOD:1641 | name | dHex(1)Hex(1)HexA(1)HexNAc(3) | def | "DHex Hex HexA HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1641] | xref | record_id "1641" | xref | delta_mono_mass "1093.380938" | xref | delta_avge_mass "1093.9835" | xref | delta_composition "dHex(1) Hex(1) HexA(1) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1094_mono_mass "1093.380938" | xref | spec_1_neutral_loss_1094_avge_mass "1093.9835" | xref | spec_1_neutral_loss_1094_flag "false" | xref | spec_1_neutral_loss_1094_composition "dHex(1) Hex(1) HexA(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1094_mono_mass "1093.380938" | xref | spec_1_neutral_loss_1094_avge_mass "1093.9835" | xref | spec_1_neutral_loss_1094_flag "false" | xref | spec_1_neutral_loss_1094_composition "dHex(1) Hex(1) HexA(1) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1642] === UNIMOD:1642 Hex(2)HexNAc(2)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1642] [cols="2*"] |
| id | UNIMOD:1642 | name | Hex(2)HexNAc(2)NeuAc(1)Sulf(1) | def | "Hex(2) HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1642] | xref | record_id "1642" | xref | delta_mono_mass "1101.316623" | xref | delta_avge_mass "1101.984" | xref | delta_composition "O(3) S Hex(2) HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:30:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1102_mono_mass "1101.316623" | xref | spec_1_neutral_loss_1102_avge_mass "1101.984" | xref | spec_1_neutral_loss_1102_flag "false" | xref | spec_1_neutral_loss_1102_composition "O(3) S Hex(2) HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1102_mono_mass "1101.316623" | xref | spec_1_neutral_loss_1102_avge_mass "1101.984" | xref | spec_1_neutral_loss_1102_flag "false" | xref | spec_1_neutral_loss_1102_composition "O(3) S Hex(2) HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1643] === UNIMOD:1643 dHex(2)Hex(2)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1643] [cols="2*"] |
| id | UNIMOD:1643 | name | dHex(2)Hex(2)HexNAc(2)Sulf(1) | def | "DHex(2) Hex(2) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1643] | xref | record_id "1643" | xref | delta_mono_mass "1102.337025" | xref | delta_avge_mass "1103.0118" | xref | delta_composition "O(3) S dHex(2) Hex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:31:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1103_mono_mass "1102.337025" | xref | spec_1_neutral_loss_1103_avge_mass "1103.0118" | xref | spec_1_neutral_loss_1103_flag "false" | xref | spec_1_neutral_loss_1103_composition "O(3) S dHex(2) Hex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1103_mono_mass "1102.337025" | xref | spec_1_neutral_loss_1103_avge_mass "1103.0118" | xref | spec_1_neutral_loss_1103_flag "false" | xref | spec_1_neutral_loss_1103_composition "O(3) S dHex(2) Hex(2) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1644] === UNIMOD:1644 dHex(2)Hex(1)HexNAc(2)Kdn(1) |
null .Term [UNIMOD:1644] [cols="2*"] |
| id | UNIMOD:1644 | name | dHex(2)Hex(1)HexNAc(2)Kdn(1) | def | "DHex(2) Hex HexNAc(2) Kdn ---OR--- Hex(2) HexNAc dHex(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1644] | xref | record_id "1644" | xref | delta_mono_mass "1110.396254" | xref | delta_avge_mass "1111.0107" | xref | delta_composition "dHex(2) Hex HexNAc(2) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 12:14:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1111_mono_mass "1110.396254" | xref | spec_1_neutral_loss_1111_avge_mass "1111.0107" | xref | spec_1_neutral_loss_1111_flag "false" | xref | spec_1_neutral_loss_1111_composition "dHex(2) Hex HexNAc(2) Kdn" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1111_mono_mass "1110.396254" | xref | spec_1_neutral_loss_1111_avge_mass "1111.0107" | xref | spec_1_neutral_loss_1111_flag "false" | xref | spec_1_neutral_loss_1111_composition "dHex(2) Hex HexNAc(2) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1645] === UNIMOD:1645 dHex(1)Hex(1)HexNAc(4) |
null .Term [UNIMOD:1645] [cols="2*"] |
| id | UNIMOD:1645 | name | dHex(1)Hex(1)HexNAc(4) | def | "DHex Hex HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1645] | xref | record_id "1645" | xref | delta_mono_mass "1120.428223" | xref | delta_avge_mass "1121.0519" | xref | delta_composition "dHex(1) Hex(1) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1121_mono_mass "1120.428223" | xref | spec_1_neutral_loss_1121_avge_mass "1121.0519" | xref | spec_1_neutral_loss_1121_flag "false" | xref | spec_1_neutral_loss_1121_composition "dHex(1) Hex(1) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1121_mono_mass "1120.428223" | xref | spec_1_neutral_loss_1121_avge_mass "1121.0519" | xref | spec_1_neutral_loss_1121_flag "false" | xref | spec_1_neutral_loss_1121_composition "dHex(1) Hex(1) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1646] === UNIMOD:1646 Hex(2)HexNAc(4) |
null .Term [UNIMOD:1646] [cols="2*"] |
| id | UNIMOD:1646 | name | Hex(2)HexNAc(4) | def | "Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1646] | xref | record_id "1646" | xref | delta_mono_mass "1136.423137" | xref | delta_avge_mass "1137.0513" | xref | delta_composition "Hex(2) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-24 11:06:46" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1137_mono_mass "1136.423137" | xref | spec_1_neutral_loss_1137_avge_mass "1137.0513" | xref | spec_1_neutral_loss_1137_flag "false" | xref | spec_1_neutral_loss_1137_composition "Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1137_mono_mass "1136.423137" | xref | spec_1_neutral_loss_1137_avge_mass "1137.0513" | xref | spec_1_neutral_loss_1137_flag "false" | xref | spec_1_neutral_loss_1137_composition "Hex(2) HexNAc(4)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1137_mono_mass "1136.423137" | xref | spec_2_neutral_loss_1137_avge_mass "1137.0513" | xref | spec_2_neutral_loss_1137_flag "false" | xref | spec_2_neutral_loss_1137_composition "Hex(2) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1647] === UNIMOD:1647 Hex(2)HexNAc(1)NeuGc(2) |
null .Term [UNIMOD:1647] [cols="2*"] |
| id | UNIMOD:1647 | name | Hex(2)HexNAc(1)NeuGc(2) | def | "Hex(2) HexNAc NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1647] | xref | record_id "1647" | xref | delta_mono_mass "1141.365682" | xref | delta_avge_mass "1141.9817" | xref | delta_composition "Hex(2) HexNAc(1) NeuGc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1142_mono_mass "1141.365682" | xref | spec_1_neutral_loss_1142_avge_mass "1141.9817" | xref | spec_1_neutral_loss_1142_flag "false" | xref | spec_1_neutral_loss_1142_composition "Hex(2) HexNAc(1) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1142_mono_mass "1141.365682" | xref | spec_1_neutral_loss_1142_avge_mass "1141.9817" | xref | spec_1_neutral_loss_1142_flag "false" | xref | spec_1_neutral_loss_1142_composition "Hex(2) HexNAc(1) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1648] === UNIMOD:1648 dHex(2)Hex(4)HexNAc(1) |
null .Term [UNIMOD:1648] [cols="2*"] |
| id | UNIMOD:1648 | name | dHex(2)Hex(4)HexNAc(1) | def | "DHex(2) Hex(4) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1648] | xref | record_id "1648" | xref | delta_mono_mass "1143.406484" | xref | delta_avge_mass "1144.0373" | xref | delta_composition "dHex(2) Hex(4) HexNAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1144_mono_mass "1143.406484" | xref | spec_1_neutral_loss_1144_avge_mass "1144.0373" | xref | spec_1_neutral_loss_1144_flag "false" | xref | spec_1_neutral_loss_1144_composition "dHex(2) Hex(4) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1144_mono_mass "1143.406484" | xref | spec_1_neutral_loss_1144_avge_mass "1144.0373" | xref | spec_1_neutral_loss_1144_flag "false" | xref | spec_1_neutral_loss_1144_composition "dHex(2) Hex(4) HexNAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1649] === UNIMOD:1649 Hex(1)HexNAc(2)NeuAc(2) |
null .Term [UNIMOD:1649] [cols="2*"] |
| id | UNIMOD:1649 | name | Hex(1)HexNAc(2)NeuAc(2) | def | "Hex HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1649] | xref | record_id "1649" | xref | delta_mono_mass "1150.402402" | xref | delta_avge_mass "1151.0348" | xref | delta_composition "Hex(1) HexNAc(2) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1151_mono_mass "1150.402402" | xref | spec_1_neutral_loss_1151_avge_mass "1151.0348" | xref | spec_1_neutral_loss_1151_flag "false" | xref | spec_1_neutral_loss_1151_composition "Hex(1) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1151_mono_mass "1150.402402" | xref | spec_1_neutral_loss_1151_avge_mass "1151.0348" | xref | spec_1_neutral_loss_1151_flag "false" | xref | spec_1_neutral_loss_1151_composition "Hex(1) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1650] === UNIMOD:1650 dHex(2)Hex(1)HexNAc(2)NeuAc(1) |
null .Term [UNIMOD:1650] [cols="2*"] |
| id | UNIMOD:1650 | name | dHex(2)Hex(1)HexNAc(2)NeuAc(1) | def | "DHex(2) Hex HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1650] | xref | record_id "1650" | xref | delta_mono_mass "1151.422803" | xref | delta_avge_mass "1152.0626" | xref | delta_composition "dHex(2) Hex(1) HexNAc(2) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1152_mono_mass "1151.422803" | xref | spec_1_neutral_loss_1152_avge_mass "1152.0626" | xref | spec_1_neutral_loss_1152_flag "false" | xref | spec_1_neutral_loss_1152_composition "dHex(2) Hex(1) HexNAc(2) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1152_mono_mass "1151.422803" | xref | spec_1_neutral_loss_1152_avge_mass "1152.0626" | xref | spec_1_neutral_loss_1152_flag "false" | xref | spec_1_neutral_loss_1152_composition "dHex(2) Hex(1) HexNAc(2) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1651] === UNIMOD:1651 dHex(1)Hex(2)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1651] [cols="2*"] |
| id | UNIMOD:1651 | name | dHex(1)Hex(2)HexNAc(3)Sulf(1) | def | "DHex Hex(2) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1651] | xref | record_id "1651" | xref | delta_mono_mass "1159.358488" | xref | delta_avge_mass "1160.0632" | xref | delta_composition "O(3) S dHex Hex(2) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:31:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1160_mono_mass "1159.358488" | xref | spec_1_neutral_loss_1160_avge_mass "1160.0632" | xref | spec_1_neutral_loss_1160_flag "false" | xref | spec_1_neutral_loss_1160_composition "O(3) S dHex Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1160_mono_mass "1159.358488" | xref | spec_1_neutral_loss_1160_avge_mass "1160.0632" | xref | spec_1_neutral_loss_1160_flag "false" | xref | spec_1_neutral_loss_1160_composition "O(3) S dHex Hex(2) HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1652] === UNIMOD:1652 dHex(1)HexNAc(5) |
null .Term [UNIMOD:1652] [cols="2*"] |
| id | UNIMOD:1652 | name | dHex(1)HexNAc(5) | def | "DHex HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1652] | xref | record_id "1652" | xref | delta_mono_mass "1161.454772" | xref | delta_avge_mass "1162.1038" | xref | delta_composition "dHex(1) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1162_mono_mass "1161.454772" | xref | spec_1_neutral_loss_1162_avge_mass "1162.1038" | xref | spec_1_neutral_loss_1162_flag "false" | xref | spec_1_neutral_loss_1162_composition "dHex(1) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1162_mono_mass "1161.454772" | xref | spec_1_neutral_loss_1162_avge_mass "1162.1038" | xref | spec_1_neutral_loss_1162_flag "false" | xref | spec_1_neutral_loss_1162_composition "dHex(1) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1653] === UNIMOD:1653 dHex(2)Hex(1)HexNAc(2)NeuGc(1) |
null .Term [UNIMOD:1653] [cols="2*"] |
| id | UNIMOD:1653 | name | dHex(2)Hex(1)HexNAc(2)NeuGc(1) | def | "DHex(2) Hex HexNAc(2) NeuGc ---OR--- Hex(2) HexNAc(2) dHex NeuAc ---OR--- Hex HexNAc(3) dHex Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1653] | xref | record_id "1653" | xref | delta_mono_mass "1167.417718" | xref | delta_avge_mass "1168.062" | xref | delta_composition "dHex(2) Hex HexNAc(2) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 12:18:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1168_mono_mass "1167.417718" | xref | spec_1_neutral_loss_1168_avge_mass "1168.062" | xref | spec_1_neutral_loss_1168_flag "false" | xref | spec_1_neutral_loss_1168_composition "dHex(2) Hex HexNAc(2) NeuGc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1168_mono_mass "1167.417718" | xref | spec_1_neutral_loss_1168_avge_mass "1168.062" | xref | spec_1_neutral_loss_1168_flag "false" | xref | spec_1_neutral_loss_1168_composition "dHex(2) Hex HexNAc(2) NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1654] === UNIMOD:1654 dHex(3)Hex(2)HexNAc(2) |
null .Term [UNIMOD:1654] [cols="2*"] |
| id | UNIMOD:1654 | name | dHex(3)Hex(2)HexNAc(2) | def | "DHex(3) Hex(2) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1654] | xref | record_id "1654" | xref | delta_mono_mass "1168.438119" | xref | delta_avge_mass "1169.0898" | xref | delta_composition "dHex(3) Hex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1169_mono_mass "1168.438119" | xref | spec_1_neutral_loss_1169_avge_mass "1169.0898" | xref | spec_1_neutral_loss_1169_flag "false" | xref | spec_1_neutral_loss_1169_composition "dHex(3) Hex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1169_mono_mass "1168.438119" | xref | spec_1_neutral_loss_1169_avge_mass "1169.0898" | xref | spec_1_neutral_loss_1169_flag "false" | xref | spec_1_neutral_loss_1169_composition "dHex(3) Hex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1655] === UNIMOD:1655 Hex(3)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1655] [cols="2*"] |
| id | UNIMOD:1655 | name | Hex(3)HexNAc(3)Sulf(1) | def | "Hex(3) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1655] | xref | record_id "1655" | xref | delta_mono_mass "1175.353403" | xref | delta_avge_mass "1176.0626" | xref | delta_composition "O(3) S Hex(3) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-24 11:08:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1176_mono_mass "1175.353403" | xref | spec_1_neutral_loss_1176_avge_mass "1176.0626" | xref | spec_1_neutral_loss_1176_flag "false" | xref | spec_1_neutral_loss_1176_composition "O(3) S Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1176_mono_mass "1175.353403" | xref | spec_1_neutral_loss_1176_avge_mass "1176.0626" | xref | spec_1_neutral_loss_1176_flag "false" | xref | spec_1_neutral_loss_1176_composition "O(3) S Hex(3) HexNAc(3)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1176_mono_mass "1175.353403" | xref | spec_2_neutral_loss_1176_avge_mass "1176.0626" | xref | spec_2_neutral_loss_1176_flag "false" | xref | spec_2_neutral_loss_1176_composition "O(3) S Hex(3) HexNAc(3)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1656] === UNIMOD:1656 dHex(2)Hex(2)HexNAc(2)Sulf(2) |
null .Term [UNIMOD:1656] [cols="2*"] |
| id | UNIMOD:1656 | name | dHex(2)Hex(2)HexNAc(2)Sulf(2) | def | "DHex(2) Hex(2) HexNAc(2) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=2&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1656] | xref | record_id "1656" | xref | delta_mono_mass "1182.293839" | xref | delta_avge_mass "1183.075" | xref | delta_composition "O(6) S(2) dHex(2) Hex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:31:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1183_mono_mass "1182.293839" | xref | spec_1_neutral_loss_1183_avge_mass "1183.075" | xref | spec_1_neutral_loss_1183_flag "false" | xref | spec_1_neutral_loss_1183_composition "O(6) S(2) dHex(2) Hex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1183_mono_mass "1182.293839" | xref | spec_1_neutral_loss_1183_avge_mass "1183.075" | xref | spec_1_neutral_loss_1183_flag "false" | xref | spec_1_neutral_loss_1183_composition "O(6) S(2) dHex(2) Hex(2) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1657] === UNIMOD:1657 dHex(1)Hex(2)HexNAc(2)NeuGc(1) |
null .Term [UNIMOD:1657] [cols="2*"] |
| id | UNIMOD:1657 | name | dHex(1)Hex(2)HexNAc(2)NeuGc(1) | def | "DHex Hex(2) HexNAc(2) NeuGc ---OR--- Hex(3) HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1657] | xref | record_id "1657" | xref | delta_mono_mass "1183.412632" | xref | delta_avge_mass "1184.0614" | xref | delta_composition "dHex Hex(2) HexNAc(2) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 13:10:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1184_mono_mass "1183.412632" | xref | spec_1_neutral_loss_1184_avge_mass "1184.0614" | xref | spec_1_neutral_loss_1184_flag "false" | xref | spec_1_neutral_loss_1184_composition "dHex Hex(2) HexNAc(2) NeuGc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1184_mono_mass "1183.412632" | xref | spec_1_neutral_loss_1184_avge_mass "1184.0614" | xref | spec_1_neutral_loss_1184_flag "false" | xref | spec_1_neutral_loss_1184_composition "dHex Hex(2) HexNAc(2) NeuGc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1184_mono_mass "1183.412632" | xref | spec_2_neutral_loss_1184_avge_mass "1184.0614" | xref | spec_2_neutral_loss_1184_flag "false" | xref | spec_2_neutral_loss_1184_composition "dHex Hex(2) HexNAc(2) NeuGc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1658] === UNIMOD:1658 dHex(1)Hex(1)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1658] [cols="2*"] |
| id | UNIMOD:1658 | name | dHex(1)Hex(1)HexNAc(3)NeuAc(1) | def | "DHex Hex HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1658] | xref | record_id "1658" | xref | delta_mono_mass "1208.444267" | xref | delta_avge_mass "1209.1139" | xref | delta_composition "dHex Hex HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-23 14:50:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1209_mono_mass "1208.444267" | xref | spec_1_neutral_loss_1209_avge_mass "1209.1139" | xref | spec_1_neutral_loss_1209_flag "false" | xref | spec_1_neutral_loss_1209_composition "dHex Hex HexNAc(3) NeuAc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1209_mono_mass "1208.444267" | xref | spec_1_neutral_loss_1209_avge_mass "1209.1139" | xref | spec_1_neutral_loss_1209_flag "false" | xref | spec_1_neutral_loss_1209_composition "dHex Hex HexNAc(3) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1659] === UNIMOD:1659 Hex(6)Phos(3) |
null .Term [UNIMOD:1659] [cols="2*"] |
| id | UNIMOD:1659 | name | Hex(6)Phos(3) | def | "Hex(6) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1659] | xref | record_id "1659" | xref | delta_mono_mass "1212.215934" | xref | delta_avge_mass "1212.7833" | xref | delta_composition "H(3) O(9) P(3) Hex(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:42:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1213_mono_mass "1212.215934" | xref | spec_1_neutral_loss_1213_avge_mass "1212.7833" | xref | spec_1_neutral_loss_1213_flag "false" | xref | spec_1_neutral_loss_1213_composition "H(3) O(9) P(3) Hex(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1213_mono_mass "1212.215934" | xref | spec_1_neutral_loss_1213_avge_mass "1212.7833" | xref | spec_1_neutral_loss_1213_flag "false" | xref | spec_1_neutral_loss_1213_composition "H(3) O(9) P(3) Hex(6)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1660] === UNIMOD:1660 dHex(1)Hex(3)HexA(1)HexNAc(2) |
null .Term [UNIMOD:1660] [cols="2*"] |
| id | UNIMOD:1660 | name | dHex(1)Hex(3)HexA(1)HexNAc(2) | def | "DHex Hex(3) HexA HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1660] | xref | record_id "1660" | xref | delta_mono_mass "1214.407213" | xref | delta_avge_mass "1215.0722" | xref | delta_composition "dHex(1) Hex(3) HexA(1) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1215_mono_mass "1214.407213" | xref | spec_1_neutral_loss_1215_avge_mass "1215.0722" | xref | spec_1_neutral_loss_1215_flag "false" | xref | spec_1_neutral_loss_1215_composition "dHex(1) Hex(3) HexA(1) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1215_mono_mass "1214.407213" | xref | spec_1_neutral_loss_1215_avge_mass "1215.0722" | xref | spec_1_neutral_loss_1215_flag "false" | xref | spec_1_neutral_loss_1215_composition "dHex(1) Hex(3) HexA(1) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1661] === UNIMOD:1661 dHex(1)Hex(1)HexNAc(3)NeuGc(1) |
null .Term [UNIMOD:1661] [cols="2*"] |
| id | UNIMOD:1661 | name | dHex(1)Hex(1)HexNAc(3)NeuGc(1) | def | "DHex Hex HexNAc(3) NeuGc ---OR--- Hex(2) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1661] | xref | record_id "1661" | xref | delta_mono_mass "1224.439181" | xref | delta_avge_mass "1225.1133" | xref | delta_composition "dHex Hex HexNAc(3) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 13:15:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1225_mono_mass "1224.439181" | xref | spec_1_neutral_loss_1225_avge_mass "1225.1133" | xref | spec_1_neutral_loss_1225_flag "false" | xref | spec_1_neutral_loss_1225_composition "dHex Hex HexNAc(3) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1225_mono_mass "1224.439181" | xref | spec_1_neutral_loss_1225_avge_mass "1225.1133" | xref | spec_1_neutral_loss_1225_flag "false" | xref | spec_1_neutral_loss_1225_composition "dHex Hex HexNAc(3) NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1662] === UNIMOD:1662 Hex(1)HexNAc(2)NeuAc(2)Sulf(1) |
null .Term [UNIMOD:1662] [cols="2*"] |
| id | UNIMOD:1662 | name | Hex(1)HexNAc(2)NeuAc(2)Sulf(1) | def | "Hex HexNAc(2) NeuAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1662] | xref | record_id "1662" | xref | delta_mono_mass "1230.359217" | xref | delta_avge_mass "1231.098" | xref | delta_composition "O(3) S Hex HexNAc(2) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:31:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1231_mono_mass "1230.359217" | xref | spec_1_neutral_loss_1231_avge_mass "1231.098" | xref | spec_1_neutral_loss_1231_flag "false" | xref | spec_1_neutral_loss_1231_composition "O(3) S Hex HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1231_mono_mass "1230.359217" | xref | spec_1_neutral_loss_1231_avge_mass "1231.098" | xref | spec_1_neutral_loss_1231_flag "false" | xref | spec_1_neutral_loss_1231_composition "O(3) S Hex HexNAc(2) NeuAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1663] === UNIMOD:1663 dHex(2)Hex(3)HexA(1)HexNAc(1)Sulf(1) |
null .Term [UNIMOD:1663] [cols="2*"] |
| id | UNIMOD:1663 | name | dHex(2)Hex(3)HexA(1)HexNAc(1)Sulf(1) | def | "DHex(2) Hex(3) HexA HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1663] | xref | record_id "1663" | xref | delta_mono_mass "1237.342563" | xref | delta_avge_mass "1238.084" | xref | delta_composition "O(3) S dHex(2) Hex(3) HexA HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:32:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1238_mono_mass "1237.342563" | xref | spec_1_neutral_loss_1238_avge_mass "1238.084" | xref | spec_1_neutral_loss_1238_flag "false" | xref | spec_1_neutral_loss_1238_composition "O(3) S dHex(2) Hex(3) HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1238_mono_mass "1237.342563" | xref | spec_1_neutral_loss_1238_avge_mass "1238.084" | xref | spec_1_neutral_loss_1238_flag "false" | xref | spec_1_neutral_loss_1238_composition "O(3) S dHex(2) Hex(3) HexA HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1664] === UNIMOD:1664 Hex(1)HexNAc(1)NeuAc(3) |
null .Term [UNIMOD:1664] [cols="2*"] |
| id | UNIMOD:1664 | name | Hex(1)HexNAc(1)NeuAc(3) | def | "Hex HexNAc NeuAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neuac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1664] | xref | record_id "1664" | xref | delta_mono_mass "1238.418446" | xref | delta_avge_mass "1239.0969" | xref | delta_composition "Hex(1) HexNAc(1) NeuAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1239_mono_mass "1238.418446" | xref | spec_1_neutral_loss_1239_avge_mass "1239.0969" | xref | spec_1_neutral_loss_1239_flag "false" | xref | spec_1_neutral_loss_1239_composition "Hex(1) HexNAc(1) NeuAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1239_mono_mass "1238.418446" | xref | spec_1_neutral_loss_1239_avge_mass "1239.0969" | xref | spec_1_neutral_loss_1239_flag "false" | xref | spec_1_neutral_loss_1239_composition "Hex(1) HexNAc(1) NeuAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1665] === UNIMOD:1665 Hex(2)HexNAc(3)NeuGc(1) |
null .Term [UNIMOD:1665] [cols="2*"] |
| id | UNIMOD:1665 | name | Hex(2)HexNAc(3)NeuGc(1) | def | "Hex(2) HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1665] | xref | record_id "1665" | xref | delta_mono_mass "1240.434096" | xref | delta_avge_mass "1241.1127" | xref | delta_composition "Hex(2) HexNAc(3) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1241_mono_mass "1240.434096" | xref | spec_1_neutral_loss_1241_avge_mass "1241.1127" | xref | spec_1_neutral_loss_1241_flag "false" | xref | spec_1_neutral_loss_1241_composition "Hex(2) HexNAc(3) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1241_mono_mass "1240.434096" | xref | spec_1_neutral_loss_1241_avge_mass "1241.1127" | xref | spec_1_neutral_loss_1241_flag "false" | xref | spec_1_neutral_loss_1241_composition "Hex(2) HexNAc(3) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1666] === UNIMOD:1666 dHex(1)Hex(2)HexNAc(2)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1666] [cols="2*"] |
| id | UNIMOD:1666 | name | dHex(1)Hex(2)HexNAc(2)NeuAc(1)Sulf(1) | def | "DHex Hex(2) HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1666] | xref | record_id "1666" | xref | delta_mono_mass "1247.374532" | xref | delta_avge_mass "1248.1252" | xref | delta_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:32:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1248_mono_mass "1247.374532" | xref | spec_1_neutral_loss_1248_avge_mass "1248.1252" | xref | spec_1_neutral_loss_1248_flag "false" | xref | spec_1_neutral_loss_1248_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1248_mono_mass "1247.374532" | xref | spec_1_neutral_loss_1248_avge_mass "1248.1252" | xref | spec_1_neutral_loss_1248_flag "false" | xref | spec_1_neutral_loss_1248_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1667] === UNIMOD:1667 dHex(3)Hex(1)HexNAc(2)Kdn(1) |
null .Term [UNIMOD:1667] [cols="2*"] |
| id | UNIMOD:1667 | name | dHex(3)Hex(1)HexNAc(2)Kdn(1) | def | "DHex(3) Hex HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=1&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1667] | xref | record_id "1667" | xref | delta_mono_mass "1256.454163" | xref | delta_avge_mass "1257.1519" | xref | delta_composition "dHex(3) Hex HexNAc(2) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:57:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1257_mono_mass "1256.454163" | xref | spec_1_neutral_loss_1257_avge_mass "1257.1519" | xref | spec_1_neutral_loss_1257_flag "false" | xref | spec_1_neutral_loss_1257_composition "dHex(3) Hex HexNAc(2) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1257_mono_mass "1256.454163" | xref | spec_1_neutral_loss_1257_avge_mass "1257.1519" | xref | spec_1_neutral_loss_1257_flag "false" | xref | spec_1_neutral_loss_1257_composition "dHex(3) Hex HexNAc(2) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1668] === UNIMOD:1668 dHex(2)Hex(3)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1668] [cols="2*"] |
| id | UNIMOD:1668 | name | dHex(2)Hex(3)HexNAc(2)Sulf(1) | def | "DHex(2) Hex(3) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1668] | xref | record_id "1668" | xref | delta_mono_mass "1264.389848" | xref | delta_avge_mass "1265.1524" | xref | delta_composition "O(3) S dHex(2) Hex(3) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:32:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1265_mono_mass "1264.389848" | xref | spec_1_neutral_loss_1265_avge_mass "1265.1524" | xref | spec_1_neutral_loss_1265_flag "false" | xref | spec_1_neutral_loss_1265_composition "O(3) S dHex(2) Hex(3) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1265_mono_mass "1264.389848" | xref | spec_1_neutral_loss_1265_avge_mass "1265.1524" | xref | spec_1_neutral_loss_1265_flag "false" | xref | spec_1_neutral_loss_1265_composition "O(3) S dHex(2) Hex(3) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1669] === UNIMOD:1669 dHex(2)Hex(2)HexNAc(2)Kdn(1) |
null .Term [UNIMOD:1669] [cols="2*"] |
| id | UNIMOD:1669 | name | dHex(2)Hex(2)HexNAc(2)Kdn(1) | def | "DHex(2) Hex(2) HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1669] | xref | record_id "1669" | xref | delta_mono_mass "1272.449077" | xref | delta_avge_mass "1273.1513" | xref | delta_composition "dHex(2) Hex(2) HexNAc(2) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:56:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1273_mono_mass "1272.449077" | xref | spec_1_neutral_loss_1273_avge_mass "1273.1513" | xref | spec_1_neutral_loss_1273_flag "false" | xref | spec_1_neutral_loss_1273_composition "dHex(2) Hex(2) HexNAc(2) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1273_mono_mass "1272.449077" | xref | spec_1_neutral_loss_1273_avge_mass "1273.1513" | xref | spec_1_neutral_loss_1273_flag "false" | xref | spec_1_neutral_loss_1273_composition "dHex(2) Hex(2) HexNAc(2) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1670] === UNIMOD:1670 dHex(2)Hex(2)HexA(1)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1670] [cols="2*"] |
| id | UNIMOD:1670 | name | dHex(2)Hex(2)HexA(1)HexNAc(2)Sulf(1) | def | "DHex(2) Hex(2) HexA HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1670] | xref | record_id "1670" | xref | delta_mono_mass "1278.369113" | xref | delta_avge_mass "1279.136" | xref | delta_composition "O(3) S dHex(2) Hex(2) HexA HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:32:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1279_mono_mass "1278.369113" | xref | spec_1_neutral_loss_1279_avge_mass "1279.136" | xref | spec_1_neutral_loss_1279_flag "false" | xref | spec_1_neutral_loss_1279_composition "O(3) S dHex(2) Hex(2) HexA HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1279_mono_mass "1278.369113" | xref | spec_1_neutral_loss_1279_avge_mass "1279.136" | xref | spec_1_neutral_loss_1279_flag "false" | xref | spec_1_neutral_loss_1279_composition "O(3) S dHex(2) Hex(2) HexA HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1671] === UNIMOD:1671 dHex(1)Hex(2)HexNAc(4) |
null .Term [UNIMOD:1671] [cols="2*"] |
| id | UNIMOD:1671 | name | dHex(1)Hex(2)HexNAc(4) | def | "DHex Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1671] | xref | record_id "1671" | xref | delta_mono_mass "1282.481046" | xref | delta_avge_mass "1283.1925" | xref | delta_composition "dHex Hex(2) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-24 12:00:46" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1283_mono_mass "1282.481046" | xref | spec_1_neutral_loss_1283_avge_mass "1283.1925" | xref | spec_1_neutral_loss_1283_flag "false" | xref | spec_1_neutral_loss_1283_composition "dHex Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1283_mono_mass "1282.481046" | xref | spec_1_neutral_loss_1283_avge_mass "1283.1925" | xref | spec_1_neutral_loss_1283_flag "false" | xref | spec_1_neutral_loss_1283_composition "dHex Hex(2) HexNAc(4)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1283_mono_mass "1282.481046" | xref | spec_2_neutral_loss_1283_avge_mass "1283.1925" | xref | spec_2_neutral_loss_1283_flag "false" | xref | spec_2_neutral_loss_1283_composition "dHex Hex(2) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1672] === UNIMOD:1672 Hex(1)HexNAc(1)NeuGc(3) |
null .Term [UNIMOD:1672] [cols="2*"] |
| id | UNIMOD:1672 | name | Hex(1)HexNAc(1)NeuGc(3) | def | "Hex HexNAc NeuGc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1672] | xref | record_id "1672" | xref | delta_mono_mass "1286.40319" | xref | delta_avge_mass "1287.0951" | xref | delta_composition "Hex(1) HexNAc(1) NeuGc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1287_mono_mass "1286.40319" | xref | spec_1_neutral_loss_1287_avge_mass "1287.0951" | xref | spec_1_neutral_loss_1287_flag "false" | xref | spec_1_neutral_loss_1287_composition "Hex(1) HexNAc(1) NeuGc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1287_mono_mass "1286.40319" | xref | spec_1_neutral_loss_1287_avge_mass "1287.0951" | xref | spec_1_neutral_loss_1287_flag "false" | xref | spec_1_neutral_loss_1287_composition "Hex(1) HexNAc(1) NeuGc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1673] === UNIMOD:1673 dHex(1)Hex(1)HexNAc(3)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1673] [cols="2*"] |
| id | UNIMOD:1673 | name | dHex(1)Hex(1)HexNAc(3)NeuAc(1)Sulf(1) | def | "DHex Hex HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1673] | xref | record_id "1673" | xref | delta_mono_mass "1288.401081" | xref | delta_avge_mass "1289.1771" | xref | delta_composition "O(3) S dHex Hex HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:32:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1289_mono_mass "1288.401081" | xref | spec_1_neutral_loss_1289_avge_mass "1289.1771" | xref | spec_1_neutral_loss_1289_flag "false" | xref | spec_1_neutral_loss_1289_composition "O(3) S dHex Hex HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1289_mono_mass "1288.401081" | xref | spec_1_neutral_loss_1289_avge_mass "1289.1771" | xref | spec_1_neutral_loss_1289_flag "false" | xref | spec_1_neutral_loss_1289_composition "O(3) S dHex Hex HexNAc(3) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1674] === UNIMOD:1674 dHex(1)Hex(3)HexA(1)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1674] [cols="2*"] |
| id | UNIMOD:1674 | name | dHex(1)Hex(3)HexA(1)HexNAc(2)Sulf(1) | def | "DHex Hex(3) HexA HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1674] | xref | record_id "1674" | xref | delta_mono_mass "1294.364027" | xref | delta_avge_mass "1295.1354" | xref | delta_composition "O(3) S dHex Hex(3) HexA HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:33:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1295_mono_mass "1294.364027" | xref | spec_1_neutral_loss_1295_avge_mass "1295.1354" | xref | spec_1_neutral_loss_1295_flag "false" | xref | spec_1_neutral_loss_1295_composition "O(3) S dHex Hex(3) HexA HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1295_mono_mass "1294.364027" | xref | spec_1_neutral_loss_1295_avge_mass "1295.1354" | xref | spec_1_neutral_loss_1295_flag "false" | xref | spec_1_neutral_loss_1295_composition "O(3) S dHex Hex(3) HexA HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1675] === UNIMOD:1675 dHex(1)Hex(1)HexNAc(2)NeuAc(2) |
null .Term [UNIMOD:1675] [cols="2*"] |
| id | UNIMOD:1675 | name | dHex(1)Hex(1)HexNAc(2)NeuAc(2) | def | "DHex Hex HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1675] | xref | record_id "1675" | xref | delta_mono_mass "1296.460311" | xref | delta_avge_mass "1297.176" | xref | delta_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1297_mono_mass "1296.460311" | xref | spec_1_neutral_loss_1297_avge_mass "1297.176" | xref | spec_1_neutral_loss_1297_flag "false" | xref | spec_1_neutral_loss_1297_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1297_mono_mass "1296.460311" | xref | spec_1_neutral_loss_1297_avge_mass "1297.176" | xref | spec_1_neutral_loss_1297_flag "false" | xref | spec_1_neutral_loss_1297_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1676] === UNIMOD:1676 dHex(3)HexNAc(3)Kdn(1) |
null .Term [UNIMOD:1676] [cols="2*"] |
| id | UNIMOD:1676 | name | dHex(3)HexNAc(3)Kdn(1) | def | "DHex(3) HexNAc(3) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1676] | xref | record_id "1676" | xref | delta_mono_mass "1297.480712" | xref | delta_avge_mass "1298.2038" | xref | delta_composition "dHex(3) HexNAc(3) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:57:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1298_mono_mass "1297.480712" | xref | spec_1_neutral_loss_1298_avge_mass "1298.2038" | xref | spec_1_neutral_loss_1298_flag "false" | xref | spec_1_neutral_loss_1298_composition "dHex(3) HexNAc(3) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1298_mono_mass "1297.480712" | xref | spec_1_neutral_loss_1298_avge_mass "1298.2038" | xref | spec_1_neutral_loss_1298_flag "false" | xref | spec_1_neutral_loss_1298_composition "dHex(3) HexNAc(3) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1678] === UNIMOD:1678 Hex(2)HexNAc(3)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1678] [cols="2*"] |
| id | UNIMOD:1678 | name | Hex(2)HexNAc(3)NeuAc(1)Sulf(1) | def | "Hex(2) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1678] | xref | record_id "1678" | xref | delta_mono_mass "1304.395996" | xref | delta_avge_mass "1305.1765" | xref | delta_composition "O(3) S Hex(2) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:33:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1305_mono_mass "1304.395996" | xref | spec_1_neutral_loss_1305_avge_mass "1305.1765" | xref | spec_1_neutral_loss_1305_flag "false" | xref | spec_1_neutral_loss_1305_composition "O(3) S Hex(2) HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1305_mono_mass "1304.395996" | xref | spec_1_neutral_loss_1305_avge_mass "1305.1765" | xref | spec_1_neutral_loss_1305_flag "false" | xref | spec_1_neutral_loss_1305_composition "O(3) S Hex(2) HexNAc(3) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1679] === UNIMOD:1679 dHex(2)Hex(2)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1679] [cols="2*"] |
| id | UNIMOD:1679 | name | dHex(2)Hex(2)HexNAc(3)Sulf(1) | def | "DHex(2) Hex(2) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1679] | xref | record_id "1679" | xref | delta_mono_mass "1305.416397" | xref | delta_avge_mass "1306.2044" | xref | delta_composition "O(3) S dHex(2) Hex(2) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:33:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1306_mono_mass "1305.416397" | xref | spec_1_neutral_loss_1306_avge_mass "1306.2044" | xref | spec_1_neutral_loss_1306_flag "false" | xref | spec_1_neutral_loss_1306_composition "O(3) S dHex(2) Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1306_mono_mass "1305.416397" | xref | spec_1_neutral_loss_1306_avge_mass "1306.2044" | xref | spec_1_neutral_loss_1306_flag "false" | xref | spec_1_neutral_loss_1306_composition "O(3) S dHex(2) Hex(2) HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1680] === UNIMOD:1680 dHex(2)HexNAc(5) |
null .Term [UNIMOD:1680] [cols="2*"] |
| id | UNIMOD:1680 | name | dHex(2)HexNAc(5) | def | "DHex(2) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1680] | xref | record_id "1680" | xref | delta_mono_mass "1307.512681" | xref | delta_avge_mass "1308.245" | xref | delta_composition "dHex(2) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1308_mono_mass "1307.512681" | xref | spec_1_neutral_loss_1308_avge_mass "1308.245" | xref | spec_1_neutral_loss_1308_flag "false" | xref | spec_1_neutral_loss_1308_composition "dHex(2) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1308_mono_mass "1307.512681" | xref | spec_1_neutral_loss_1308_avge_mass "1308.245" | xref | spec_1_neutral_loss_1308_flag "false" | xref | spec_1_neutral_loss_1308_composition "dHex(2) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1681] === UNIMOD:1681 Hex(2)HexNAc(2)NeuAc(2) |
null .Term [UNIMOD:1681] [cols="2*"] |
| id | UNIMOD:1681 | name | Hex(2)HexNAc(2)NeuAc(2) | def | "Hex(2) HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1681] | xref | record_id "1681" | xref | delta_mono_mass "1312.455225" | xref | delta_avge_mass "1313.1754" | xref | delta_composition "Hex(2) HexNAc(2) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1313_mono_mass "1312.455225" | xref | spec_1_neutral_loss_1313_avge_mass "1313.1754" | xref | spec_1_neutral_loss_1313_flag "false" | xref | spec_1_neutral_loss_1313_composition "Hex(2) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1313_mono_mass "1312.455225" | xref | spec_1_neutral_loss_1313_avge_mass "1313.1754" | xref | spec_1_neutral_loss_1313_flag "false" | xref | spec_1_neutral_loss_1313_composition "Hex(2) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1682] === UNIMOD:1682 dHex(2)Hex(2)HexNAc(2)NeuAc(1) |
null .Term [UNIMOD:1682] [cols="2*"] |
| id | UNIMOD:1682 | name | dHex(2)Hex(2)HexNAc(2)NeuAc(1) | def | "DHex(2) Hex(2) HexNAc(2) NeuAc ---OR--- Hex HexNAc(3) dHex(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1682] | xref | record_id "1682" | xref | delta_mono_mass "1313.475627" | xref | delta_avge_mass "1314.2032" | xref | delta_composition "dHex(2) Hex(2) HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 13:21:07" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1314_mono_mass "1313.475627" | xref | spec_1_neutral_loss_1314_avge_mass "1314.2032" | xref | spec_1_neutral_loss_1314_flag "false" | xref | spec_1_neutral_loss_1314_composition "dHex(2) Hex(2) HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1314_mono_mass "1313.475627" | xref | spec_1_neutral_loss_1314_avge_mass "1314.2032" | xref | spec_1_neutral_loss_1314_flag "false" | xref | spec_1_neutral_loss_1314_composition "dHex(2) Hex(2) HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1683] === UNIMOD:1683 dHex(1)Hex(3)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1683] [cols="2*"] |
| id | UNIMOD:1683 | name | dHex(1)Hex(3)HexNAc(3)Sulf(1) | def | "DHex Hex(3) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1683] | xref | record_id "1683" | xref | delta_mono_mass "1321.411312" | xref | delta_avge_mass "1322.2038" | xref | delta_composition "O(3) S dHex Hex(3) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:33:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1322_mono_mass "1321.411312" | xref | spec_1_neutral_loss_1322_avge_mass "1322.2038" | xref | spec_1_neutral_loss_1322_flag "false" | xref | spec_1_neutral_loss_1322_composition "O(3) S dHex Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1322_mono_mass "1321.411312" | xref | spec_1_neutral_loss_1322_avge_mass "1322.2038" | xref | spec_1_neutral_loss_1322_flag "false" | xref | spec_1_neutral_loss_1322_composition "O(3) S dHex Hex(3) HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1684] === UNIMOD:1684 dHex(2)Hex(2)HexNAc(2)NeuGc(1) |
null .Term [UNIMOD:1684] [cols="2*"] |
| id | UNIMOD:1684 | name | dHex(2)Hex(2)HexNAc(2)NeuGc(1) | def | "DHex(2) Hex(2) HexNAc(2) NeuGc ---OR--- Hex(3) HexNAc(2) dHex NeuAc ---OR--- Hex(2) HexNAc(3) dHex Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1684] | xref | record_id "1684" | xref | delta_mono_mass "1329.470541" | xref | delta_avge_mass "1330.2026" | xref | delta_composition "dHex(2) Hex(2) HexNAc(2) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 13:27:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1330_mono_mass "1329.470541" | xref | spec_1_neutral_loss_1330_avge_mass "1330.2026" | xref | spec_1_neutral_loss_1330_flag "false" | xref | spec_1_neutral_loss_1330_composition "dHex(2) Hex(2) HexNAc(2) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1330_mono_mass "1329.470541" | xref | spec_1_neutral_loss_1330_avge_mass "1330.2026" | xref | spec_1_neutral_loss_1330_flag "false" | xref | spec_1_neutral_loss_1330_composition "dHex(2) Hex(2) HexNAc(2) NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1685] === UNIMOD:1685 Hex(2)HexNAc(5) |
null .Term [UNIMOD:1685] [cols="2*"] |
| id | UNIMOD:1685 | name | Hex(2)HexNAc(5) | def | "Hex(2) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1685] | xref | record_id "1685" | xref | delta_mono_mass "1339.50251" | xref | delta_avge_mass "1340.2438" | xref | delta_composition "Hex(2) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1340_mono_mass "1339.50251" | xref | spec_1_neutral_loss_1340_avge_mass "1340.2438" | xref | spec_1_neutral_loss_1340_flag "false" | xref | spec_1_neutral_loss_1340_composition "Hex(2) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1340_mono_mass "1339.50251" | xref | spec_1_neutral_loss_1340_avge_mass "1340.2438" | xref | spec_1_neutral_loss_1340_flag "false" | xref | spec_1_neutral_loss_1340_composition "Hex(2) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1686] === UNIMOD:1686 dHex(1)Hex(3)HexNAc(2)NeuGc(1) |
null .Term [UNIMOD:1686] [cols="2*"] |
| id | UNIMOD:1686 | name | dHex(1)Hex(3)HexNAc(2)NeuGc(1) | def | "DHex Hex(3) HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1686] | xref | record_id "1686" | xref | delta_mono_mass "1345.465456" | xref | delta_avge_mass "1346.202" | xref | delta_composition "dHex(1) Hex(3) HexNAc(2) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1346_mono_mass "1345.465456" | xref | spec_1_neutral_loss_1346_avge_mass "1346.202" | xref | spec_1_neutral_loss_1346_flag "false" | xref | spec_1_neutral_loss_1346_composition "dHex(1) Hex(3) HexNAc(2) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1346_mono_mass "1345.465456" | xref | spec_1_neutral_loss_1346_avge_mass "1346.202" | xref | spec_1_neutral_loss_1346_flag "false" | xref | spec_1_neutral_loss_1346_composition "dHex(1) Hex(3) HexNAc(2) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1687] === UNIMOD:1687 Hex(1)HexNAc(3)NeuAc(2) |
null .Term [UNIMOD:1687] [cols="2*"] |
| id | UNIMOD:1687 | name | Hex(1)HexNAc(3)NeuAc(2) | def | "Hex HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1687] | xref | record_id "1687" | xref | delta_mono_mass "1353.481775" | xref | delta_avge_mass "1354.2273" | xref | delta_composition "Hex(1) HexNAc(3) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1354_mono_mass "1353.481775" | xref | spec_1_neutral_loss_1354_avge_mass "1354.2273" | xref | spec_1_neutral_loss_1354_flag "false" | xref | spec_1_neutral_loss_1354_composition "Hex(1) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1354_mono_mass "1353.481775" | xref | spec_1_neutral_loss_1354_avge_mass "1354.2273" | xref | spec_1_neutral_loss_1354_flag "false" | xref | spec_1_neutral_loss_1354_composition "Hex(1) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1688] === UNIMOD:1688 dHex(1)Hex(2)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1688] [cols="2*"] |
| id | UNIMOD:1688 | name | dHex(1)Hex(2)HexNAc(3)NeuAc(1) | def | "DHex Hex(2) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1688] | xref | record_id "1688" | xref | delta_mono_mass "1370.49709" | xref | delta_avge_mass "1371.2545" | xref | delta_composition "dHex(1) Hex(2) HexNAc(3) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1371_mono_mass "1370.49709" | xref | spec_1_neutral_loss_1371_avge_mass "1371.2545" | xref | spec_1_neutral_loss_1371_flag "false" | xref | spec_1_neutral_loss_1371_composition "dHex(1) Hex(2) HexNAc(3) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1371_mono_mass "1370.49709" | xref | spec_1_neutral_loss_1371_avge_mass "1371.2545" | xref | spec_1_neutral_loss_1371_flag "false" | xref | spec_1_neutral_loss_1371_composition "dHex(1) Hex(2) HexNAc(3) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1689] === UNIMOD:1689 dHex(3)Hex(2)HexNAc(3) |
null .Term [UNIMOD:1689] [cols="2*"] |
| id | UNIMOD:1689 | name | dHex(3)Hex(2)HexNAc(3) | def | "DHex(3) Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1689] | xref | record_id "1689" | xref | delta_mono_mass "1371.517491" | xref | delta_avge_mass "1372.2824" | xref | delta_composition "dHex(3) Hex(2) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1372_mono_mass "1371.517491" | xref | spec_1_neutral_loss_1372_avge_mass "1372.2824" | xref | spec_1_neutral_loss_1372_flag "false" | xref | spec_1_neutral_loss_1372_composition "dHex(3) Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1372_mono_mass "1371.517491" | xref | spec_1_neutral_loss_1372_avge_mass "1372.2824" | xref | spec_1_neutral_loss_1372_flag "false" | xref | spec_1_neutral_loss_1372_composition "dHex(3) Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1690] === UNIMOD:1690 Hex(7)Phos(3) |
null .Term [UNIMOD:1690] [cols="2*"] |
| id | UNIMOD:1690 | name | Hex(7)Phos(3) | def | "Hex(7) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=7&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1690] | xref | record_id "1690" | xref | delta_mono_mass "1374.268757" | xref | delta_avge_mass "1374.9239" | xref | delta_composition "H(3) O(9) P(3) Hex(7)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:43:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1375_mono_mass "1374.268757" | xref | spec_1_neutral_loss_1375_avge_mass "1374.9239" | xref | spec_1_neutral_loss_1375_flag "false" | xref | spec_1_neutral_loss_1375_composition "H(3) O(9) P(3) Hex(7)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1375_mono_mass "1374.268757" | xref | spec_1_neutral_loss_1375_avge_mass "1374.9239" | xref | spec_1_neutral_loss_1375_flag "false" | xref | spec_1_neutral_loss_1375_composition "H(3) O(9) P(3) Hex(7)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1691] === UNIMOD:1691 dHex(1)Hex(4)HexA(1)HexNAc(2) |
null .Term [UNIMOD:1691] [cols="2*"] |
| id | UNIMOD:1691 | name | dHex(1)Hex(4)HexA(1)HexNAc(2) | def | "DHex Hex(4) HexA HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1691] | xref | record_id "1691" | xref | delta_mono_mass "1376.460036" | xref | delta_avge_mass "1377.2128" | xref | delta_composition "dHex(1) Hex(4) HexA(1) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1377_mono_mass "1376.460036" | xref | spec_1_neutral_loss_1377_avge_mass "1377.2128" | xref | spec_1_neutral_loss_1377_flag "false" | xref | spec_1_neutral_loss_1377_composition "dHex(1) Hex(4) HexA(1) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1377_mono_mass "1376.460036" | xref | spec_1_neutral_loss_1377_avge_mass "1377.2128" | xref | spec_1_neutral_loss_1377_flag "false" | xref | spec_1_neutral_loss_1377_composition "dHex(1) Hex(4) HexA(1) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1692] === UNIMOD:1692 Hex(3)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1692] [cols="2*"] |
| id | UNIMOD:1692 | name | Hex(3)HexNAc(3)NeuAc(1) | def | "Hex(3) HexNAc(3) NeuAc ---OR--- Hex(2) HexNAc(3) dHex NeuGc ---OR--- Hex(2) HexNAc(4) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1692] | xref | record_id "1692" | xref | delta_mono_mass "1386.492005" | xref | delta_avge_mass "1387.2539" | xref | delta_composition "Hex(3) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 15:15:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1387_mono_mass "1386.492005" | xref | spec_1_neutral_loss_1387_avge_mass "1387.2539" | xref | spec_1_neutral_loss_1387_flag "false" | xref | spec_1_neutral_loss_1387_composition "Hex(3) HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1387_mono_mass "1386.492005" | xref | spec_1_neutral_loss_1387_avge_mass "1387.2539" | xref | spec_1_neutral_loss_1387_flag "false" | xref | spec_1_neutral_loss_1387_composition "Hex(3) HexNAc(3) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1693] === UNIMOD:1693 dHex(1)Hex(3)HexA(2)HexNAc(2) |
null .Term [UNIMOD:1693] [cols="2*"] |
| id | UNIMOD:1693 | name | dHex(1)Hex(3)HexA(2)HexNAc(2) | def | "DHex Hex(3) HexA(2) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexa=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1693] | xref | record_id "1693" | xref | delta_mono_mass "1390.439301" | xref | delta_avge_mass "1391.1963" | xref | delta_composition "dHex(1) Hex(3) HexA(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1391_mono_mass "1390.439301" | xref | spec_1_neutral_loss_1391_avge_mass "1391.1963" | xref | spec_1_neutral_loss_1391_flag "false" | xref | spec_1_neutral_loss_1391_composition "dHex(1) Hex(3) HexA(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1391_mono_mass "1390.439301" | xref | spec_1_neutral_loss_1391_avge_mass "1391.1963" | xref | spec_1_neutral_loss_1391_flag "false" | xref | spec_1_neutral_loss_1391_composition "dHex(1) Hex(3) HexA(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1694] === UNIMOD:1694 Hex(2)HexNAc(2)NeuAc(2)Sulf(1) |
null .Term [UNIMOD:1694] [cols="2*"] |
| id | UNIMOD:1694 | name | Hex(2)HexNAc(2)NeuAc(2)Sulf(1) | def | "Hex(2) HexNAc(2) NeuAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1694] | xref | record_id "1694" | xref | delta_mono_mass "1392.41204" | xref | delta_avge_mass "1393.2386" | xref | delta_composition "O(3) S Hex(2) HexNAc(2) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:34:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1393_mono_mass "1392.41204" | xref | spec_1_neutral_loss_1393_avge_mass "1393.2386" | xref | spec_1_neutral_loss_1393_flag "false" | xref | spec_1_neutral_loss_1393_composition "O(3) S Hex(2) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1393_mono_mass "1392.41204" | xref | spec_1_neutral_loss_1393_avge_mass "1393.2386" | xref | spec_1_neutral_loss_1393_flag "false" | xref | spec_1_neutral_loss_1393_composition "O(3) S Hex(2) HexNAc(2) NeuAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1695] === UNIMOD:1695 dHex(2)Hex(2)HexNAc(2)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1695] [cols="2*"] |
| id | UNIMOD:1695 | name | dHex(2)Hex(2)HexNAc(2)NeuAc(1)Sulf(1) | def | "DHex(2) Hex(2) HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1695] | xref | record_id "1695" | xref | delta_mono_mass "1393.432441" | xref | delta_avge_mass "1394.2664" | xref | delta_composition "O(3) S dHex(2) Hex(2) HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:34:15" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1394_mono_mass "1393.432441" | xref | spec_1_neutral_loss_1394_avge_mass "1394.2664" | xref | spec_1_neutral_loss_1394_flag "false" | xref | spec_1_neutral_loss_1394_composition "O(3) S dHex(2) Hex(2) HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1394_mono_mass "1393.432441" | xref | spec_1_neutral_loss_1394_avge_mass "1394.2664" | xref | spec_1_neutral_loss_1394_flag "false" | xref | spec_1_neutral_loss_1394_composition "O(3) S dHex(2) Hex(2) HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1696] === UNIMOD:1696 Hex(3)HexNAc(3)NeuGc(1) |
null .Term [UNIMOD:1696] [cols="2*"] |
| id | UNIMOD:1696 | name | Hex(3)HexNAc(3)NeuGc(1) | def | "Hex(3) HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1696] | xref | record_id "1696" | xref | delta_mono_mass "1402.48692" | xref | delta_avge_mass "1403.2533" | xref | delta_composition "Hex(3) HexNAc(3) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1403_mono_mass "1402.48692" | xref | spec_1_neutral_loss_1403_avge_mass "1403.2533" | xref | spec_1_neutral_loss_1403_flag "false" | xref | spec_1_neutral_loss_1403_composition "Hex(3) HexNAc(3) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1403_mono_mass "1402.48692" | xref | spec_1_neutral_loss_1403_avge_mass "1403.2533" | xref | spec_1_neutral_loss_1403_flag "false" | xref | spec_1_neutral_loss_1403_composition "Hex(3) HexNAc(3) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1697] === UNIMOD:1697 dHex(4)Hex(1)HexNAc(2)Kdn(1) |
null .Term [UNIMOD:1697] [cols="2*"] |
| id | UNIMOD:1697 | name | dHex(4)Hex(1)HexNAc(2)Kdn(1) | def | "DHex(4) Hex HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=1&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1697] | xref | record_id "1697" | xref | delta_mono_mass "1402.512072" | xref | delta_avge_mass "1403.2931" | xref | delta_composition "dHex(4) Hex HexNAc(2) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:56:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1403_mono_mass "1402.512072" | xref | spec_1_neutral_loss_1403_avge_mass "1403.2931" | xref | spec_1_neutral_loss_1403_flag "false" | xref | spec_1_neutral_loss_1403_composition "dHex(4) Hex HexNAc(2) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1403_mono_mass "1402.512072" | xref | spec_1_neutral_loss_1403_avge_mass "1403.2931" | xref | spec_1_neutral_loss_1403_flag "false" | xref | spec_1_neutral_loss_1403_composition "dHex(4) Hex HexNAc(2) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1698] === UNIMOD:1698 dHex(3)Hex(2)HexNAc(2)Kdn(1) |
null .Term [UNIMOD:1698] [cols="2*"] |
| id | UNIMOD:1698 | name | dHex(3)Hex(2)HexNAc(2)Kdn(1) | def | "DHex(3) Hex(2) HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1698] | xref | record_id "1698" | xref | delta_mono_mass "1418.506986" | xref | delta_avge_mass "1419.2925" | xref | delta_composition "dHex(3) Hex(2) HexNAc(2) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:56:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1419_mono_mass "1418.506986" | xref | spec_1_neutral_loss_1419_avge_mass "1419.2925" | xref | spec_1_neutral_loss_1419_flag "false" | xref | spec_1_neutral_loss_1419_composition "dHex(3) Hex(2) HexNAc(2) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1419_mono_mass "1418.506986" | xref | spec_1_neutral_loss_1419_avge_mass "1419.2925" | xref | spec_1_neutral_loss_1419_flag "false" | xref | spec_1_neutral_loss_1419_composition "dHex(3) Hex(2) HexNAc(2) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1699] === UNIMOD:1699 dHex(3)Hex(2)HexA(1)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1699] [cols="2*"] |
| id | UNIMOD:1699 | name | dHex(3)Hex(2)HexA(1)HexNAc(2)Sulf(1) | def | "DHex(3) Hex(2) HexA HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=3&hex=2&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1699] | xref | record_id "1699" | xref | delta_mono_mass "1424.427021" | xref | delta_avge_mass "1425.2772" | xref | delta_composition "O(3) S dHex(3) Hex(2) HexA HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:55:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1425_mono_mass "1424.427021" | xref | spec_1_neutral_loss_1425_avge_mass "1425.2772" | xref | spec_1_neutral_loss_1425_flag "false" | xref | spec_1_neutral_loss_1425_composition "O(3) S dHex(3) Hex(2) HexA HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1425_mono_mass "1424.427021" | xref | spec_1_neutral_loss_1425_avge_mass "1425.2772" | xref | spec_1_neutral_loss_1425_flag "false" | xref | spec_1_neutral_loss_1425_composition "O(3) S dHex(3) Hex(2) HexA HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1700] === UNIMOD:1700 Hex(2)HexNAc(4)NeuAc(1) |
null .Term [UNIMOD:1700] [cols="2*"] |
| id | UNIMOD:1700 | name | Hex(2)HexNAc(4)NeuAc(1) | def | "Hex(2) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1700] | xref | record_id "1700" | xref | delta_mono_mass "1427.518554" | xref | delta_avge_mass "1428.3059" | xref | delta_composition "Hex(2) HexNAc(4) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1428_mono_mass "1427.518554" | xref | spec_1_neutral_loss_1428_avge_mass "1428.3059" | xref | spec_1_neutral_loss_1428_flag "false" | xref | spec_1_neutral_loss_1428_composition "Hex(2) HexNAc(4) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1428_mono_mass "1427.518554" | xref | spec_1_neutral_loss_1428_avge_mass "1428.3059" | xref | spec_1_neutral_loss_1428_flag "false" | xref | spec_1_neutral_loss_1428_composition "Hex(2) HexNAc(4) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1701] === UNIMOD:1701 dHex(2)Hex(2)HexNAc(4) |
null .Term [UNIMOD:1701] [cols="2*"] |
| id | UNIMOD:1701 | name | dHex(2)Hex(2)HexNAc(4) | def | "DHex(2) Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1701] | xref | record_id "1701" | xref | delta_mono_mass "1428.538955" | xref | delta_avge_mass "1429.3337" | xref | delta_composition "dHex(2) Hex(2) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1429_mono_mass "1428.538955" | xref | spec_1_neutral_loss_1429_avge_mass "1429.3337" | xref | spec_1_neutral_loss_1429_flag "false" | xref | spec_1_neutral_loss_1429_composition "dHex(2) Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1429_mono_mass "1428.538955" | xref | spec_1_neutral_loss_1429_avge_mass "1429.3337" | xref | spec_1_neutral_loss_1429_flag "false" | xref | spec_1_neutral_loss_1429_composition "dHex(2) Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1702] === UNIMOD:1702 dHex(2)Hex(3)HexA(1)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1702] [cols="2*"] |
| id | UNIMOD:1702 | name | dHex(2)Hex(3)HexA(1)HexNAc(2)Sulf(1) | def | "DHex(2) Hex(3) HexA HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1702] | xref | record_id "1702" | xref | delta_mono_mass "1440.421936" | xref | delta_avge_mass "1441.2766" | xref | delta_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:55:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1441_mono_mass "1440.421936" | xref | spec_1_neutral_loss_1441_avge_mass "1441.2766" | xref | spec_1_neutral_loss_1441_flag "false" | xref | spec_1_neutral_loss_1441_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1441_mono_mass "1440.421936" | xref | spec_1_neutral_loss_1441_avge_mass "1441.2766" | xref | spec_1_neutral_loss_1441_flag "false" | xref | spec_1_neutral_loss_1441_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1703] === UNIMOD:1703 dHex(4)HexNAc(3)Kdn(1) |
null .Term [UNIMOD:1703] [cols="2*"] |
| id | UNIMOD:1703 | name | dHex(4)HexNAc(3)Kdn(1) | def | "DHex(4) HexNAc(3) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1703] | xref | record_id "1703" | xref | delta_mono_mass "1443.538621" | xref | delta_avge_mass "1444.345" | xref | delta_composition "dHex(4) HexNAc(3) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:56:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1444_mono_mass "1443.538621" | xref | spec_1_neutral_loss_1444_avge_mass "1444.345" | xref | spec_1_neutral_loss_1444_flag "false" | xref | spec_1_neutral_loss_1444_composition "dHex(4) HexNAc(3) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1444_mono_mass "1443.538621" | xref | spec_1_neutral_loss_1444_avge_mass "1444.345" | xref | spec_1_neutral_loss_1444_flag "false" | xref | spec_1_neutral_loss_1444_composition "dHex(4) HexNAc(3) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1705] === UNIMOD:1705 Hex(2)HexNAc(1)NeuGc(3) |
null .Term [UNIMOD:1705] [cols="2*"] |
| id | UNIMOD:1705 | name | Hex(2)HexNAc(1)NeuGc(3) | def | "Hex(2) HexNAc NeuGc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&neugc=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1705] | xref | record_id "1705" | xref | delta_mono_mass "1448.456013" | xref | delta_avge_mass "1449.2357" | xref | delta_composition "Hex(2) HexNAc(1) NeuGc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1449_mono_mass "1448.456013" | xref | spec_1_neutral_loss_1449_avge_mass "1449.2357" | xref | spec_1_neutral_loss_1449_flag "false" | xref | spec_1_neutral_loss_1449_composition "Hex(2) HexNAc(1) NeuGc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1449_mono_mass "1448.456013" | xref | spec_1_neutral_loss_1449_avge_mass "1449.2357" | xref | spec_1_neutral_loss_1449_flag "false" | xref | spec_1_neutral_loss_1449_composition "Hex(2) HexNAc(1) NeuGc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1706] === UNIMOD:1706 dHex(4)Hex(1)HexNAc(1)Kdn(2) |
null .Term [UNIMOD:1706] [cols="2*"] |
| id | UNIMOD:1706 | name | dHex(4)Hex(1)HexNAc(1)Kdn(2) | def | "DHex(4) Hex HexNAc Kdn(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=1&hexnac=1&kdn=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1706] | xref | record_id "1706" | xref | delta_mono_mass "1449.501567" | xref | delta_avge_mass "1450.3032" | xref | delta_composition "dHex(4) Hex HexNAc Kdn(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:56:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1450_mono_mass "1449.501567" | xref | spec_1_neutral_loss_1450_avge_mass "1450.3032" | xref | spec_1_neutral_loss_1450_flag "false" | xref | spec_1_neutral_loss_1450_composition "dHex(4) Hex HexNAc Kdn(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1450_mono_mass "1449.501567" | xref | spec_1_neutral_loss_1450_avge_mass "1450.3032" | xref | spec_1_neutral_loss_1450_flag "false" | xref | spec_1_neutral_loss_1450_composition "dHex(4) Hex HexNAc Kdn(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1707] === UNIMOD:1707 dHex(1)Hex(2)HexNAc(3)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1707] [cols="2*"] |
| id | UNIMOD:1707 | name | dHex(1)Hex(2)HexNAc(3)NeuAc(1)Sulf(1) | def | "DHex Hex(2) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1707] | xref | record_id "1707" | xref | delta_mono_mass "1450.453905" | xref | delta_avge_mass "1451.3177" | xref | delta_composition "O(3) S dHex Hex(2) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:55:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1451_mono_mass "1450.453905" | xref | spec_1_neutral_loss_1451_avge_mass "1451.3177" | xref | spec_1_neutral_loss_1451_flag "false" | xref | spec_1_neutral_loss_1451_composition "O(3) S dHex Hex(2) HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1451_mono_mass "1450.453905" | xref | spec_1_neutral_loss_1451_avge_mass "1451.3177" | xref | spec_1_neutral_loss_1451_flag "false" | xref | spec_1_neutral_loss_1451_composition "O(3) S dHex Hex(2) HexNAc(3) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1708] === UNIMOD:1708 dHex(1)Hex(2)HexNAc(2)NeuAc(2) |
null .Term [UNIMOD:1708] [cols="2*"] |
| id | UNIMOD:1708 | name | dHex(1)Hex(2)HexNAc(2)NeuAc(2) | def | "DHex Hex(2) HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1708] | xref | record_id "1708" | xref | delta_mono_mass "1458.513134" | xref | delta_avge_mass "1459.3166" | xref | delta_composition "dHex(1) Hex(2) HexNAc(2) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1459_mono_mass "1458.513134" | xref | spec_1_neutral_loss_1459_avge_mass "1459.3166" | xref | spec_1_neutral_loss_1459_flag "false" | xref | spec_1_neutral_loss_1459_composition "dHex(1) Hex(2) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1459_mono_mass "1458.513134" | xref | spec_1_neutral_loss_1459_avge_mass "1459.3166" | xref | spec_1_neutral_loss_1459_flag "false" | xref | spec_1_neutral_loss_1459_composition "dHex(1) Hex(2) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1709] === UNIMOD:1709 dHex(3)Hex(1)HexNAc(3)Kdn(1) |
null .Term [UNIMOD:1709] [cols="2*"] |
| id | UNIMOD:1709 | name | dHex(3)Hex(1)HexNAc(3)Kdn(1) | def | "DHex(3) Hex HexNAc(3) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=1&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1709] | xref | record_id "1709" | xref | delta_mono_mass "1459.533535" | xref | delta_avge_mass "1460.3444" | xref | delta_composition "dHex(3) Hex HexNAc(3) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:56:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1460_mono_mass "1459.533535" | xref | spec_1_neutral_loss_1460_avge_mass "1460.3444" | xref | spec_1_neutral_loss_1460_flag "false" | xref | spec_1_neutral_loss_1460_composition "dHex(3) Hex HexNAc(3) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1460_mono_mass "1459.533535" | xref | spec_1_neutral_loss_1460_avge_mass "1460.3444" | xref | spec_1_neutral_loss_1460_flag "false" | xref | spec_1_neutral_loss_1460_composition "dHex(3) Hex HexNAc(3) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1711] === UNIMOD:1711 Hex(3)HexNAc(3)NeuAc(1)Sulf(1) |
null .Term [UNIMOD:1711] [cols="2*"] |
| id | UNIMOD:1711 | name | Hex(3)HexNAc(3)NeuAc(1)Sulf(1) | def | "Hex(3) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1711] | xref | record_id "1711" | xref | delta_mono_mass "1466.44882" | xref | delta_avge_mass "1467.3171" | xref | delta_composition "O(3) S Hex(3) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:55:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1467_mono_mass "1466.44882" | xref | spec_1_neutral_loss_1467_avge_mass "1467.3171" | xref | spec_1_neutral_loss_1467_flag "false" | xref | spec_1_neutral_loss_1467_composition "O(3) S Hex(3) HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1467_mono_mass "1466.44882" | xref | spec_1_neutral_loss_1467_avge_mass "1467.3171" | xref | spec_1_neutral_loss_1467_flag "false" | xref | spec_1_neutral_loss_1467_composition "O(3) S Hex(3) HexNAc(3) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1712] === UNIMOD:1712 Hex(3)HexNAc(2)NeuAc(2) |
null .Term [UNIMOD:1712] [cols="2*"] |
| id | UNIMOD:1712 | name | Hex(3)HexNAc(2)NeuAc(2) | def | "Hex(3) HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1712] | xref | record_id "1712" | xref | delta_mono_mass "1474.508049" | xref | delta_avge_mass "1475.316" | xref | delta_composition "Hex(3) HexNAc(2) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1475_mono_mass "1474.508049" | xref | spec_1_neutral_loss_1475_avge_mass "1475.316" | xref | spec_1_neutral_loss_1475_flag "false" | xref | spec_1_neutral_loss_1475_composition "Hex(3) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1475_mono_mass "1474.508049" | xref | spec_1_neutral_loss_1475_avge_mass "1475.316" | xref | spec_1_neutral_loss_1475_flag "false" | xref | spec_1_neutral_loss_1475_composition "Hex(3) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1713] === UNIMOD:1713 Hex(3)HexNAc(3)NeuGc(1)Sulf(1) |
null .Term [UNIMOD:1713] [cols="2*"] |
| id | UNIMOD:1713 | name | Hex(3)HexNAc(3)NeuGc(1)Sulf(1) | def | "Hex(3) HexNAc(3) NeuGc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1713] | xref | record_id "1713" | xref | delta_mono_mass "1482.443734" | xref | delta_avge_mass "1483.3165" | xref | delta_composition "O(3) S Hex(3) HexNAc(3) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:55:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1483_mono_mass "1482.443734" | xref | spec_1_neutral_loss_1483_avge_mass "1483.3165" | xref | spec_1_neutral_loss_1483_flag "false" | xref | spec_1_neutral_loss_1483_composition "O(3) S Hex(3) HexNAc(3) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1483_mono_mass "1482.443734" | xref | spec_1_neutral_loss_1483_avge_mass "1483.3165" | xref | spec_1_neutral_loss_1483_flag "false" | xref | spec_1_neutral_loss_1483_composition "O(3) S Hex(3) HexNAc(3) NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1714] === UNIMOD:1714 dHex(1)Hex(2)HexNAc(2)NeuGc(2) |
null .Term [UNIMOD:1714] [cols="2*"] |
| id | UNIMOD:1714 | name | dHex(1)Hex(2)HexNAc(2)NeuGc(2) | def | "DHex Hex(2) HexNAc(2) NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1714] | xref | record_id "1714" | xref | delta_mono_mass "1490.502964" | xref | delta_avge_mass "1491.3154" | xref | delta_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1491_mono_mass "1490.502964" | xref | spec_1_neutral_loss_1491_avge_mass "1491.3154" | xref | spec_1_neutral_loss_1491_flag "false" | xref | spec_1_neutral_loss_1491_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1491_mono_mass "1490.502964" | xref | spec_1_neutral_loss_1491_avge_mass "1491.3154" | xref | spec_1_neutral_loss_1491_flag "false" | xref | spec_1_neutral_loss_1491_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1715] === UNIMOD:1715 dHex(2)Hex(3)HexNAc(2)NeuGc(1) |
null .Term [UNIMOD:1715] [cols="2*"] |
| id | UNIMOD:1715 | name | dHex(2)Hex(3)HexNAc(2)NeuGc(1) | def | "DHex(2) Hex(3) HexNAc(2) NeuGc ---OR--- Hex(4) HexNAc(2) dHex NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1715] | xref | record_id "1715" | xref | delta_mono_mass "1491.523365" | xref | delta_avge_mass "1492.3432" | xref | delta_composition "dHex(2) Hex(3) HexNAc(2) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 15:37:46" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1492_mono_mass "1491.523365" | xref | spec_1_neutral_loss_1492_avge_mass "1492.3432" | xref | spec_1_neutral_loss_1492_flag "false" | xref | spec_1_neutral_loss_1492_composition "dHex(2) Hex(3) HexNAc(2) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1492_mono_mass "1491.523365" | xref | spec_1_neutral_loss_1492_avge_mass "1492.3432" | xref | spec_1_neutral_loss_1492_flag "false" | xref | spec_1_neutral_loss_1492_composition "dHex(2) Hex(3) HexNAc(2) NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1716] === UNIMOD:1716 dHex(1)Hex(3)HexA(1)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1716] [cols="2*"] |
| id | UNIMOD:1716 | name | dHex(1)Hex(3)HexA(1)HexNAc(3)Sulf(1) | def | "DHex Hex(3) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1716] | xref | record_id "1716" | xref | delta_mono_mass "1497.4434" | xref | delta_avge_mass "1498.3279" | xref | delta_composition "O(3) S dHex Hex(3) HexA HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:54:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1498_mono_mass "1497.4434" | xref | spec_1_neutral_loss_1498_avge_mass "1498.3279" | xref | spec_1_neutral_loss_1498_flag "false" | xref | spec_1_neutral_loss_1498_composition "O(3) S dHex Hex(3) HexA HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1498_mono_mass "1497.4434" | xref | spec_1_neutral_loss_1498_avge_mass "1498.3279" | xref | spec_1_neutral_loss_1498_flag "false" | xref | spec_1_neutral_loss_1498_composition "O(3) S dHex Hex(3) HexA HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1717] === UNIMOD:1717 Hex(2)HexNAc(3)NeuAc(2) |
null .Term [UNIMOD:1717] [cols="2*"] |
| id | UNIMOD:1717 | name | Hex(2)HexNAc(3)NeuAc(2) | def | "Hex(2) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1717] | xref | record_id "1717" | xref | delta_mono_mass "1515.534598" | xref | delta_avge_mass "1516.3679" | xref | delta_composition "Hex(2) HexNAc(3) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1516_mono_mass "1515.534598" | xref | spec_1_neutral_loss_1516_avge_mass "1516.3679" | xref | spec_1_neutral_loss_1516_flag "false" | xref | spec_1_neutral_loss_1516_composition "Hex(2) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1516_mono_mass "1515.534598" | xref | spec_1_neutral_loss_1516_avge_mass "1516.3679" | xref | spec_1_neutral_loss_1516_flag "false" | xref | spec_1_neutral_loss_1516_composition "Hex(2) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1718] === UNIMOD:1718 dHex(2)Hex(2)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1718] [cols="2*"] |
| id | UNIMOD:1718 | name | dHex(2)Hex(2)HexNAc(3)NeuAc(1) | def | "DHex(2) Hex(2) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1718] | xref | record_id "1718" | xref | delta_mono_mass "1516.554999" | xref | delta_avge_mass "1517.3957" | xref | delta_composition "dHex(2) Hex(2) HexNAc(3) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1517_mono_mass "1516.554999" | xref | spec_1_neutral_loss_1517_avge_mass "1517.3957" | xref | spec_1_neutral_loss_1517_flag "false" | xref | spec_1_neutral_loss_1517_composition "dHex(2) Hex(2) HexNAc(3) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1517_mono_mass "1516.554999" | xref | spec_1_neutral_loss_1517_avge_mass "1517.3957" | xref | spec_1_neutral_loss_1517_flag "false" | xref | spec_1_neutral_loss_1517_composition "dHex(2) Hex(2) HexNAc(3) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1719] === UNIMOD:1719 dHex(4)Hex(2)HexNAc(3) |
null .Term [UNIMOD:1719] [cols="2*"] |
| id | UNIMOD:1719 | name | dHex(4)Hex(2)HexNAc(3) | def | "DHex(4) Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1719] | xref | record_id "1719" | xref | delta_mono_mass "1517.5754" | xref | delta_avge_mass "1518.4236" | xref | delta_composition "dHex(4) Hex(2) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1518_mono_mass "1517.5754" | xref | spec_1_neutral_loss_1518_avge_mass "1518.4236" | xref | spec_1_neutral_loss_1518_flag "false" | xref | spec_1_neutral_loss_1518_composition "dHex(4) Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1518_mono_mass "1517.5754" | xref | spec_1_neutral_loss_1518_avge_mass "1518.4236" | xref | spec_1_neutral_loss_1518_flag "false" | xref | spec_1_neutral_loss_1518_composition "dHex(4) Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1720] === UNIMOD:1720 Hex(2)HexNAc(3)NeuAc(1)NeuGc(1) |
null .Term [UNIMOD:1720] [cols="2*"] |
| id | UNIMOD:1720 | name | Hex(2)HexNAc(3)NeuAc(1)NeuGc(1) | def | "Hex(2) HexNAc(3) NeuAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neuac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1720] | xref | record_id "1720" | xref | delta_mono_mass "1531.529513" | xref | delta_avge_mass "1532.3673" | xref | delta_composition "Hex(2) HexNAc(3) NeuAc(1) NeuGc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1532_mono_mass "1531.529513" | xref | spec_1_neutral_loss_1532_avge_mass "1532.3673" | xref | spec_1_neutral_loss_1532_flag "false" | xref | spec_1_neutral_loss_1532_composition "Hex(2) HexNAc(3) NeuAc(1) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1532_mono_mass "1531.529513" | xref | spec_1_neutral_loss_1532_avge_mass "1532.3673" | xref | spec_1_neutral_loss_1532_flag "false" | xref | spec_1_neutral_loss_1532_composition "Hex(2) HexNAc(3) NeuAc(1) NeuGc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1721] === UNIMOD:1721 dHex(2)Hex(2)HexNAc(3)NeuGc(1) |
null .Term [UNIMOD:1721] [cols="2*"] |
| id | UNIMOD:1721 | name | dHex(2)Hex(2)HexNAc(3)NeuGc(1) | def | "DHex(2) Hex(2) HexNAc(3) NeuGc ---OR--- Hex(3) HexNAc(3) dHex NeuAc ---OR--- Hex(2) HexNAc(4) dHex Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1721] | xref | record_id "1721" | xref | delta_mono_mass "1532.549914" | xref | delta_avge_mass "1533.3951" | xref | delta_composition "dHex(2) Hex(2) HexNAc(3) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 15:40:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1533_mono_mass "1532.549914" | xref | spec_1_neutral_loss_1533_avge_mass "1533.3951" | xref | spec_1_neutral_loss_1533_flag "false" | xref | spec_1_neutral_loss_1533_composition "dHex(2) Hex(2) HexNAc(3) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1533_mono_mass "1532.549914" | xref | spec_1_neutral_loss_1533_avge_mass "1533.3951" | xref | spec_1_neutral_loss_1533_flag "false" | xref | spec_1_neutral_loss_1533_composition "dHex(2) Hex(2) HexNAc(3) NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1722] === UNIMOD:1722 dHex(3)Hex(3)HexNAc(3) |
null .Term [UNIMOD:1722] [cols="2*"] |
| id | UNIMOD:1722 | name | dHex(3)Hex(3)HexNAc(3) | def | "DHex(3) Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1722] | xref | record_id "1722" | xref | delta_mono_mass "1533.570315" | xref | delta_avge_mass "1534.423" | xref | delta_composition "dHex(3) Hex(3) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1534_mono_mass "1533.570315" | xref | spec_1_neutral_loss_1534_avge_mass "1534.423" | xref | spec_1_neutral_loss_1534_flag "false" | xref | spec_1_neutral_loss_1534_composition "dHex(3) Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1534_mono_mass "1533.570315" | xref | spec_1_neutral_loss_1534_avge_mass "1534.423" | xref | spec_1_neutral_loss_1534_flag "false" | xref | spec_1_neutral_loss_1534_composition "dHex(3) Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1723] === UNIMOD:1723 Hex(8)Phos(3) |
null .Term [UNIMOD:1723] [cols="2*"] |
| id | UNIMOD:1723 | name | Hex(8)Phos(3) | def | "Hex(8) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=8&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1723] | xref | record_id "1723" | xref | delta_mono_mass "1536.321581" | xref | delta_avge_mass "1537.0645" | xref | delta_composition "H(3) O(9) P(3) Hex(8)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:43:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1537_mono_mass "1536.321581" | xref | spec_1_neutral_loss_1537_avge_mass "1537.0645" | xref | spec_1_neutral_loss_1537_flag "false" | xref | spec_1_neutral_loss_1537_composition "H(3) O(9) P(3) Hex(8)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1537_mono_mass "1536.321581" | xref | spec_1_neutral_loss_1537_avge_mass "1537.0645" | xref | spec_1_neutral_loss_1537_flag "false" | xref | spec_1_neutral_loss_1537_composition "H(3) O(9) P(3) Hex(8)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1724] === UNIMOD:1724 dHex(1)Hex(2)HexNAc(2)NeuAc(2)Sulf(1) |
null .Term [UNIMOD:1724] [cols="2*"] |
| id | UNIMOD:1724 | name | dHex(1)Hex(2)HexNAc(2)NeuAc(2)Sulf(1) | def | "DHex Hex(2) HexNAc(2) NeuAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1724] | xref | record_id "1724" | xref | delta_mono_mass "1538.469949" | xref | delta_avge_mass "1539.3798" | xref | delta_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:54:39" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1539_mono_mass "1538.469949" | xref | spec_1_neutral_loss_1539_avge_mass "1539.3798" | xref | spec_1_neutral_loss_1539_flag "false" | xref | spec_1_neutral_loss_1539_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1539_mono_mass "1538.469949" | xref | spec_1_neutral_loss_1539_avge_mass "1539.3798" | xref | spec_1_neutral_loss_1539_flag "false" | xref | spec_1_neutral_loss_1539_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1725] === UNIMOD:1725 Hex(2)HexNAc(3)NeuGc(2) |
null .Term [UNIMOD:1725] [cols="2*"] |
| id | UNIMOD:1725 | name | Hex(2)HexNAc(3)NeuGc(2) | def | "Hex(2) HexNAc(3) NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1725] | xref | record_id "1725" | xref | delta_mono_mass "1547.524427" | xref | delta_avge_mass "1548.3667" | xref | delta_composition "Hex(2) HexNAc(3) NeuGc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1548_mono_mass "1547.524427" | xref | spec_1_neutral_loss_1548_avge_mass "1548.3667" | xref | spec_1_neutral_loss_1548_flag "false" | xref | spec_1_neutral_loss_1548_composition "Hex(2) HexNAc(3) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1548_mono_mass "1547.524427" | xref | spec_1_neutral_loss_1548_avge_mass "1548.3667" | xref | spec_1_neutral_loss_1548_flag "false" | xref | spec_1_neutral_loss_1548_composition "Hex(2) HexNAc(3) NeuGc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1726] === UNIMOD:1726 dHex(4)Hex(2)HexNAc(2)Kdn(1) |
null .Term [UNIMOD:1726] [cols="2*"] |
| id | UNIMOD:1726 | name | dHex(4)Hex(2)HexNAc(2)Kdn(1) | def | "DHex(4) Hex(2) HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=2&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1726] | xref | record_id "1726" | xref | delta_mono_mass "1564.564895" | xref | delta_avge_mass "1565.4337" | xref | delta_composition "dHex(4) Hex(2) HexNAc(2) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:56:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1565_mono_mass "1564.564895" | xref | spec_1_neutral_loss_1565_avge_mass "1565.4337" | xref | spec_1_neutral_loss_1565_flag "false" | xref | spec_1_neutral_loss_1565_composition "dHex(4) Hex(2) HexNAc(2) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1565_mono_mass "1564.564895" | xref | spec_1_neutral_loss_1565_avge_mass "1565.4337" | xref | spec_1_neutral_loss_1565_flag "false" | xref | spec_1_neutral_loss_1565_composition "dHex(4) Hex(2) HexNAc(2) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1727] === UNIMOD:1727 dHex(1)Hex(2)HexNAc(4)NeuAc(1) |
null .Term [UNIMOD:1727] [cols="2*"] |
| id | UNIMOD:1727 | name | dHex(1)Hex(2)HexNAc(4)NeuAc(1) | def | "DHex Hex(2) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1727] | xref | record_id "1727" | xref | delta_mono_mass "1573.576463" | xref | delta_avge_mass "1574.4471" | xref | delta_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1574_mono_mass "1573.576463" | xref | spec_1_neutral_loss_1574_avge_mass "1574.4471" | xref | spec_1_neutral_loss_1574_flag "false" | xref | spec_1_neutral_loss_1574_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1574_mono_mass "1573.576463" | xref | spec_1_neutral_loss_1574_avge_mass "1574.4471" | xref | spec_1_neutral_loss_1574_flag "false" | xref | spec_1_neutral_loss_1574_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1728] === UNIMOD:1728 dHex(3)Hex(2)HexNAc(4) |
null .Term [UNIMOD:1728] [cols="2*"] |
| id | UNIMOD:1728 | name | dHex(3)Hex(2)HexNAc(4) | def | "DHex(3) Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1728] | xref | record_id "1728" | xref | delta_mono_mass "1574.596864" | xref | delta_avge_mass "1575.4749" | xref | delta_composition "dHex(3) Hex(2) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1575_mono_mass "1574.596864" | xref | spec_1_neutral_loss_1575_avge_mass "1575.4749" | xref | spec_1_neutral_loss_1575_flag "false" | xref | spec_1_neutral_loss_1575_composition "dHex(3) Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1575_mono_mass "1574.596864" | xref | spec_1_neutral_loss_1575_avge_mass "1575.4749" | xref | spec_1_neutral_loss_1575_flag "false" | xref | spec_1_neutral_loss_1575_composition "dHex(3) Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1729] === UNIMOD:1729 Hex(1)HexNAc(1)NeuGc(4) |
null .Term [UNIMOD:1729] [cols="2*"] |
| id | UNIMOD:1729 | name | Hex(1)HexNAc(1)NeuGc(4) | def | "Hex HexNAc NeuGc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1729] | xref | record_id "1729" | xref | delta_mono_mass "1593.493521" | xref | delta_avge_mass "1594.349" | xref | delta_composition "Hex(1) HexNAc(1) NeuGc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1594_mono_mass "1593.493521" | xref | spec_1_neutral_loss_1594_avge_mass "1594.349" | xref | spec_1_neutral_loss_1594_flag "false" | xref | spec_1_neutral_loss_1594_composition "Hex(1) HexNAc(1) NeuGc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1594_mono_mass "1593.493521" | xref | spec_1_neutral_loss_1594_avge_mass "1594.349" | xref | spec_1_neutral_loss_1594_flag "false" | xref | spec_1_neutral_loss_1594_composition "Hex(1) HexNAc(1) NeuGc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1730] === UNIMOD:1730 dHex(4)Hex(1)HexNAc(3)Kdn(1) |
null .Term [UNIMOD:1730] [cols="2*"] |
| id | UNIMOD:1730 | name | dHex(4)Hex(1)HexNAc(3)Kdn(1) | def | "DHex(4) Hex HexNAc(3) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=1&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1730] | xref | record_id "1730" | xref | delta_mono_mass "1605.591444" | xref | delta_avge_mass "1606.4856" | xref | delta_composition "dHex(4) Hex HexNAc(3) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 15:55:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1606_mono_mass "1605.591444" | xref | spec_1_neutral_loss_1606_avge_mass "1606.4856" | xref | spec_1_neutral_loss_1606_flag "false" | xref | spec_1_neutral_loss_1606_composition "dHex(4) Hex HexNAc(3) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1606_mono_mass "1605.591444" | xref | spec_1_neutral_loss_1606_avge_mass "1606.4856" | xref | spec_1_neutral_loss_1606_flag "false" | xref | spec_1_neutral_loss_1606_composition "dHex(4) Hex HexNAc(3) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1732] === UNIMOD:1732 Hex(4)HexNAc(4)Sulf(2) |
null .Term [UNIMOD:1732] [cols="2*"] |
| id | UNIMOD:1732 | name | Hex(4)HexNAc(4)Sulf(2) | def | "Hex(4) HexNAc(4) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1732] | xref | record_id "1732" | xref | delta_mono_mass "1620.442414" | xref | delta_avge_mass "1621.4589" | xref | delta_composition "O(6) S(2) Hex(4) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 10:35:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1621_mono_mass "1620.442414" | xref | spec_1_neutral_loss_1621_avge_mass "1621.4589" | xref | spec_1_neutral_loss_1621_flag "false" | xref | spec_1_neutral_loss_1621_composition "O(6) S(2) Hex(4) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1621_mono_mass "1620.442414" | xref | spec_1_neutral_loss_1621_avge_mass "1621.4589" | xref | spec_1_neutral_loss_1621_flag "false" | xref | spec_1_neutral_loss_1621_composition "O(6) S(2) Hex(4) HexNAc(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1733] === UNIMOD:1733 dHex(3)Hex(2)HexNAc(3)Kdn(1) |
null .Term [UNIMOD:1733] [cols="2*"] |
| id | UNIMOD:1733 | name | dHex(3)Hex(2)HexNAc(3)Kdn(1) | def | "DHex(3) Hex(2) HexNAc(3) Kdn ---OR--- Hex(3) HexNAc(2) dHex(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1733] | xref | record_id "1733" | xref | delta_mono_mass "1621.586359" | xref | delta_avge_mass "1622.485" | xref | delta_composition "dHex(3) Hex(2) HexNAc(3) Kdn" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-22 10:37:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1622_mono_mass "1621.586359" | xref | spec_1_neutral_loss_1622_avge_mass "1622.485" | xref | spec_1_neutral_loss_1622_flag "false" | xref | spec_1_neutral_loss_1622_composition "dHex(3) Hex(2) HexNAc(3) Kdn" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1622_mono_mass "1621.586359" | xref | spec_1_neutral_loss_1622_avge_mass "1622.485" | xref | spec_1_neutral_loss_1622_flag "false" | xref | spec_1_neutral_loss_1622_composition "dHex(3) Hex(2) HexNAc(3) Kdn" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1735] === UNIMOD:1735 dHex(2)Hex(2)HexNAc(5) |
null .Term [UNIMOD:1735] [cols="2*"] |
| id | UNIMOD:1735 | name | dHex(2)Hex(2)HexNAc(5) | def | "DHex(2) Hex(2) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1735] | xref | record_id "1735" | xref | delta_mono_mass "1631.618328" | xref | delta_avge_mass "1632.5262" | xref | delta_composition "dHex(2) Hex(2) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1632_mono_mass "1631.618328" | xref | spec_1_neutral_loss_1632_avge_mass "1632.5262" | xref | spec_1_neutral_loss_1632_flag "false" | xref | spec_1_neutral_loss_1632_composition "dHex(2) Hex(2) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1632_mono_mass "1631.618328" | xref | spec_1_neutral_loss_1632_avge_mass "1632.5262" | xref | spec_1_neutral_loss_1632_flag "false" | xref | spec_1_neutral_loss_1632_composition "dHex(2) Hex(2) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1736] === UNIMOD:1736 dHex(2)Hex(3)HexA(1)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1736] [cols="2*"] |
| id | UNIMOD:1736 | name | dHex(2)Hex(3)HexA(1)HexNAc(3)Sulf(1) | def | "DHex(2) Hex(3) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1736] | xref | record_id "1736" | xref | delta_mono_mass "1643.501309" | xref | delta_avge_mass "1644.4691" | xref | delta_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:54:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1644_mono_mass "1643.501309" | xref | spec_1_neutral_loss_1644_avge_mass "1644.4691" | xref | spec_1_neutral_loss_1644_flag "false" | xref | spec_1_neutral_loss_1644_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1644_mono_mass "1643.501309" | xref | spec_1_neutral_loss_1644_avge_mass "1644.4691" | xref | spec_1_neutral_loss_1644_flag "false" | xref | spec_1_neutral_loss_1644_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1737] === UNIMOD:1737 dHex(1)Hex(4)HexA(1)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1737] [cols="2*"] |
| id | UNIMOD:1737 | name | dHex(1)Hex(4)HexA(1)HexNAc(3)Sulf(1) | def | "DHex Hex(4) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1737] | xref | record_id "1737" | xref | delta_mono_mass "1659.496223" | xref | delta_avge_mass "1660.4685" | xref | delta_composition "O(3) S dHex Hex(4) HexA HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:54:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1660_mono_mass "1659.496223" | xref | spec_1_neutral_loss_1660_avge_mass "1660.4685" | xref | spec_1_neutral_loss_1660_flag "false" | xref | spec_1_neutral_loss_1660_composition "O(3) S dHex Hex(4) HexA HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1660_mono_mass "1659.496223" | xref | spec_1_neutral_loss_1660_avge_mass "1660.4685" | xref | spec_1_neutral_loss_1660_flag "false" | xref | spec_1_neutral_loss_1660_composition "O(3) S dHex Hex(4) HexA HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1738] === UNIMOD:1738 Hex(3)HexNAc(3)NeuAc(2) |
null .Term [UNIMOD:1738] [cols="2*"] |
| id | UNIMOD:1738 | name | Hex(3)HexNAc(3)NeuAc(2) | def | "Hex(3) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1738] | xref | record_id "1738" | xref | delta_mono_mass "1677.587422" | xref | delta_avge_mass "1678.5085" | xref | delta_composition "Hex(3) HexNAc(3) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1678_mono_mass "1677.587422" | xref | spec_1_neutral_loss_1678_avge_mass "1678.5085" | xref | spec_1_neutral_loss_1678_flag "false" | xref | spec_1_neutral_loss_1678_composition "Hex(3) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1678_mono_mass "1677.587422" | xref | spec_1_neutral_loss_1678_avge_mass "1678.5085" | xref | spec_1_neutral_loss_1678_flag "false" | xref | spec_1_neutral_loss_1678_composition "Hex(3) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1739] === UNIMOD:1739 dHex(2)Hex(3)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1739] [cols="2*"] |
| id | UNIMOD:1739 | name | dHex(2)Hex(3)HexNAc(3)NeuAc(1) | def | "DHex(2) Hex(3) HexNAc(3) NeuAc ---OR--- Hex(2) HexNAc(4) dHex(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1739] | xref | record_id "1739" | xref | delta_mono_mass "1678.607823" | xref | delta_avge_mass "1679.5363" | xref | delta_composition "dHex(2) Hex(3) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-22 10:51:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1679_mono_mass "1678.607823" | xref | spec_1_neutral_loss_1679_avge_mass "1679.5363" | xref | spec_1_neutral_loss_1679_flag "false" | xref | spec_1_neutral_loss_1679_composition "dHex(2) Hex(3) HexNAc(3) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1679_mono_mass "1678.607823" | xref | spec_1_neutral_loss_1679_avge_mass "1679.5363" | xref | spec_1_neutral_loss_1679_flag "false" | xref | spec_1_neutral_loss_1679_composition "dHex(2) Hex(3) HexNAc(3) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1740] === UNIMOD:1740 dHex(4)Hex(3)HexNAc(3) |
null .Term [UNIMOD:1740] [cols="2*"] |
| id | UNIMOD:1740 | name | dHex(4)Hex(3)HexNAc(3) | def | "DHex(4) Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1740] | xref | record_id "1740" | xref | delta_mono_mass "1679.628224" | xref | delta_avge_mass "1680.5642" | xref | delta_composition "dHex(4) Hex(3) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1680_mono_mass "1679.628224" | xref | spec_1_neutral_loss_1680_avge_mass "1680.5642" | xref | spec_1_neutral_loss_1680_flag "false" | xref | spec_1_neutral_loss_1680_composition "dHex(4) Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1680_mono_mass "1679.628224" | xref | spec_1_neutral_loss_1680_avge_mass "1680.5642" | xref | spec_1_neutral_loss_1680_flag "false" | xref | spec_1_neutral_loss_1680_composition "dHex(4) Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1742] === UNIMOD:1742 Hex(9)Phos(3) |
null .Term [UNIMOD:1742] [cols="2*"] |
| id | UNIMOD:1742 | name | Hex(9)Phos(3) | def | "Hex(9) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=9&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1742] | xref | record_id "1742" | xref | delta_mono_mass "1698.374404" | xref | delta_avge_mass "1699.2051" | xref | delta_composition "H(3) O(9) P(3) Hex(9)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:47:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1699_mono_mass "1698.374404" | xref | spec_1_neutral_loss_1699_avge_mass "1699.2051" | xref | spec_1_neutral_loss_1699_flag "false" | xref | spec_1_neutral_loss_1699_composition "H(3) O(9) P(3) Hex(9)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1699_mono_mass "1698.374404" | xref | spec_1_neutral_loss_1699_avge_mass "1699.2051" | xref | spec_1_neutral_loss_1699_flag "false" | xref | spec_1_neutral_loss_1699_composition "H(3) O(9) P(3) Hex(9)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1743] === UNIMOD:1743 dHex(2)HexNAc(7) |
null .Term [UNIMOD:1743] [cols="2*"] |
| id | UNIMOD:1743 | name | dHex(2)HexNAc(7) | def | "DHex(2) HexNAc(7)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=7&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1743] | xref | record_id "1743" | xref | delta_mono_mass "1713.671426" | xref | delta_avge_mass "1714.63" | xref | delta_composition "dHex(2) HexNAc(7)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1714_mono_mass "1713.671426" | xref | spec_1_neutral_loss_1714_avge_mass "1714.63" | xref | spec_1_neutral_loss_1714_flag "false" | xref | spec_1_neutral_loss_1714_composition "dHex(2) HexNAc(7)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1714_mono_mass "1713.671426" | xref | spec_1_neutral_loss_1714_avge_mass "1714.63" | xref | spec_1_neutral_loss_1714_flag "false" | xref | spec_1_neutral_loss_1714_composition "dHex(2) HexNAc(7)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1744] === UNIMOD:1744 Hex(2)HexNAc(1)NeuGc(4) |
null .Term [UNIMOD:1744] [cols="2*"] |
| id | UNIMOD:1744 | name | Hex(2)HexNAc(1)NeuGc(4) | def | "Hex(2) HexNAc NeuGc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&neugc=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1744] | xref | record_id "1744" | xref | delta_mono_mass "1755.546345" | xref | delta_avge_mass "1756.4896" | xref | delta_composition "Hex(2) HexNAc(1) NeuGc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1756_mono_mass "1755.546345" | xref | spec_1_neutral_loss_1756_avge_mass "1756.4896" | xref | spec_1_neutral_loss_1756_flag "false" | xref | spec_1_neutral_loss_1756_composition "Hex(2) HexNAc(1) NeuGc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1756_mono_mass "1755.546345" | xref | spec_1_neutral_loss_1756_avge_mass "1756.4896" | xref | spec_1_neutral_loss_1756_flag "false" | xref | spec_1_neutral_loss_1756_composition "Hex(2) HexNAc(1) NeuGc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1745] === UNIMOD:1745 Hex(3)HexNAc(3)NeuAc(2)Sulf(1) |
null .Term [UNIMOD:1745] [cols="2*"] |
| id | UNIMOD:1745 | name | Hex(3)HexNAc(3)NeuAc(2)Sulf(1) | def | "Hex(3) HexNAc(3) NeuAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1745] | xref | record_id "1745" | xref | delta_mono_mass "1757.544236" | xref | delta_avge_mass "1758.5717" | xref | delta_composition "O(3) S Hex(3) HexNAc(3) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:54:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1758_mono_mass "1757.544236" | xref | spec_1_neutral_loss_1758_avge_mass "1758.5717" | xref | spec_1_neutral_loss_1758_flag "false" | xref | spec_1_neutral_loss_1758_composition "O(3) S Hex(3) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1758_mono_mass "1757.544236" | xref | spec_1_neutral_loss_1758_avge_mass "1758.5717" | xref | spec_1_neutral_loss_1758_flag "false" | xref | spec_1_neutral_loss_1758_composition "O(3) S Hex(3) HexNAc(3) NeuAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1746] === UNIMOD:1746 dHex(2)Hex(3)HexNAc(5) |
null .Term [UNIMOD:1746] [cols="2*"] |
| id | UNIMOD:1746 | name | dHex(2)Hex(3)HexNAc(5) | def | "DHex(2) Hex(3) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1746] | xref | record_id "1746" | xref | delta_mono_mass "1793.671151" | xref | delta_avge_mass "1794.6668" | xref | delta_composition "dHex(2) Hex(3) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-24 13:43:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1794_mono_mass "1793.671151" | xref | spec_1_neutral_loss_1794_avge_mass "1794.6668" | xref | spec_1_neutral_loss_1794_flag "false" | xref | spec_1_neutral_loss_1794_composition "dHex(2) Hex(3) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1794_mono_mass "1793.671151" | xref | spec_1_neutral_loss_1794_avge_mass "1794.6668" | xref | spec_1_neutral_loss_1794_flag "false" | xref | spec_1_neutral_loss_1794_composition "dHex(2) Hex(3) HexNAc(5)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1794_mono_mass "1793.671151" | xref | spec_2_neutral_loss_1794_avge_mass "1794.6668" | xref | spec_2_neutral_loss_1794_flag "false" | xref | spec_2_neutral_loss_1794_composition "dHex(2) Hex(3) HexNAc(5)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1747] === UNIMOD:1747 dHex(1)Hex(2)HexNAc(2)NeuGc(3) |
null .Term [UNIMOD:1747] [cols="2*"] |
| id | UNIMOD:1747 | name | dHex(1)Hex(2)HexNAc(2)NeuGc(3) | def | "DHex Hex(2) HexNAc(2) NeuGc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&neugc=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1747] | xref | record_id "1747" | xref | delta_mono_mass "1797.593295" | xref | delta_avge_mass "1798.5694" | xref | delta_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1798_mono_mass "1797.593295" | xref | spec_1_neutral_loss_1798_avge_mass "1798.5694" | xref | spec_1_neutral_loss_1798_flag "false" | xref | spec_1_neutral_loss_1798_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1798_mono_mass "1797.593295" | xref | spec_1_neutral_loss_1798_avge_mass "1798.5694" | xref | spec_1_neutral_loss_1798_flag "false" | xref | spec_1_neutral_loss_1798_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1748] === UNIMOD:1748 dHex(2)Hex(4)HexA(1)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1748] [cols="2*"] |
| id | UNIMOD:1748 | name | dHex(2)Hex(4)HexA(1)HexNAc(3)Sulf(1) | def | "DHex(2) Hex(4) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=4&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1748] | xref | record_id "1748" | xref | delta_mono_mass "1805.554132" | xref | delta_avge_mass "1806.6097" | xref | delta_composition "O(3) S dHex(2) Hex(4) HexA HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:53:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1806_mono_mass "1805.554132" | xref | spec_1_neutral_loss_1806_avge_mass "1806.6097" | xref | spec_1_neutral_loss_1806_flag "false" | xref | spec_1_neutral_loss_1806_composition "O(3) S dHex(2) Hex(4) HexA HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1806_mono_mass "1805.554132" | xref | spec_1_neutral_loss_1806_avge_mass "1806.6097" | xref | spec_1_neutral_loss_1806_flag "false" | xref | spec_1_neutral_loss_1806_composition "O(3) S dHex(2) Hex(4) HexA HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1749] === UNIMOD:1749 Hex(2)HexNAc(3)NeuAc(3) |
null .Term [UNIMOD:1749] [cols="2*"] |
| id | UNIMOD:1749 | name | Hex(2)HexNAc(3)NeuAc(3) | def | "Hex(2) HexNAc(3) NeuAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neuac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1749] | xref | record_id "1749" | xref | delta_mono_mass "1806.630015" | xref | delta_avge_mass "1807.6225" | xref | delta_composition "Hex(2) HexNAc(3) NeuAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1807_mono_mass "1806.630015" | xref | spec_1_neutral_loss_1807_avge_mass "1807.6225" | xref | spec_1_neutral_loss_1807_flag "false" | xref | spec_1_neutral_loss_1807_composition "Hex(2) HexNAc(3) NeuAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1807_mono_mass "1806.630015" | xref | spec_1_neutral_loss_1807_avge_mass "1807.6225" | xref | spec_1_neutral_loss_1807_flag "false" | xref | spec_1_neutral_loss_1807_composition "Hex(2) HexNAc(3) NeuAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1750] === UNIMOD:1750 dHex(1)Hex(3)HexNAc(3)NeuAc(2) |
null .Term [UNIMOD:1750] [cols="2*"] |
| id | UNIMOD:1750 | name | dHex(1)Hex(3)HexNAc(3)NeuAc(2) | def | "DHex Hex(3) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1750] | xref | record_id "1750" | xref | delta_mono_mass "1823.64533" | xref | delta_avge_mass "1824.6497" | xref | delta_composition "dHex(1) Hex(3) HexNAc(3) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1824_mono_mass "1823.64533" | xref | spec_1_neutral_loss_1824_avge_mass "1824.6497" | xref | spec_1_neutral_loss_1824_flag "false" | xref | spec_1_neutral_loss_1824_composition "dHex(1) Hex(3) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1824_mono_mass "1823.64533" | xref | spec_1_neutral_loss_1824_avge_mass "1824.6497" | xref | spec_1_neutral_loss_1824_flag "false" | xref | spec_1_neutral_loss_1824_composition "dHex(1) Hex(3) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1751] === UNIMOD:1751 dHex(3)Hex(3)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1751] [cols="2*"] |
| id | UNIMOD:1751 | name | dHex(3)Hex(3)HexNAc(3)NeuAc(1) | def | "DHex(3) Hex(3) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1751] | xref | record_id "1751" | xref | delta_mono_mass "1824.665732" | xref | delta_avge_mass "1825.6775" | xref | delta_composition "dHex(3) Hex(3) HexNAc(3) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1825_mono_mass "1824.665732" | xref | spec_1_neutral_loss_1825_avge_mass "1825.6775" | xref | spec_1_neutral_loss_1825_flag "false" | xref | spec_1_neutral_loss_1825_composition "dHex(3) Hex(3) HexNAc(3) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1825_mono_mass "1824.665732" | xref | spec_1_neutral_loss_1825_avge_mass "1825.6775" | xref | spec_1_neutral_loss_1825_flag "false" | xref | spec_1_neutral_loss_1825_composition "dHex(3) Hex(3) HexNAc(3) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1752] === UNIMOD:1752 Hex(2)HexNAc(3)NeuGc(3) |
null .Term [UNIMOD:1752] [cols="2*"] |
| id | UNIMOD:1752 | name | Hex(2)HexNAc(3)NeuGc(3) | def | "Hex(2) HexNAc(3) NeuGc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neugc=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1752] | xref | record_id "1752" | xref | delta_mono_mass "1854.614759" | xref | delta_avge_mass "1855.6207" | xref | delta_composition "Hex(2) HexNAc(3) NeuGc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1855_mono_mass "1854.614759" | xref | spec_1_neutral_loss_1855_avge_mass "1855.6207" | xref | spec_1_neutral_loss_1855_flag "false" | xref | spec_1_neutral_loss_1855_composition "Hex(2) HexNAc(3) NeuGc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1855_mono_mass "1854.614759" | xref | spec_1_neutral_loss_1855_avge_mass "1855.6207" | xref | spec_1_neutral_loss_1855_flag "false" | xref | spec_1_neutral_loss_1855_composition "Hex(2) HexNAc(3) NeuGc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1753] === UNIMOD:1753 Hex(10)Phos(3) |
null .Term [UNIMOD:1753] [cols="2*"] |
| id | UNIMOD:1753 | name | Hex(10)Phos(3) | def | "Hex(10) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=10&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1753] | xref | record_id "1753" | xref | delta_mono_mass "1860.427228" | xref | delta_avge_mass "1861.3457" | xref | delta_composition "H(3) O(9) P(3) Hex(10)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:51:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1861_mono_mass "1860.427228" | xref | spec_1_neutral_loss_1861_avge_mass "1861.3457" | xref | spec_1_neutral_loss_1861_flag "false" | xref | spec_1_neutral_loss_1861_composition "H(3) O(9) P(3) Hex(10)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1861_mono_mass "1860.427228" | xref | spec_1_neutral_loss_1861_avge_mass "1861.3457" | xref | spec_1_neutral_loss_1861_flag "false" | xref | spec_1_neutral_loss_1861_composition "H(3) O(9) P(3) Hex(10)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1754] === UNIMOD:1754 dHex(1)Hex(2)HexNAc(4)NeuAc(2) |
null .Term [UNIMOD:1754] [cols="2*"] |
| id | UNIMOD:1754 | name | dHex(1)Hex(2)HexNAc(4)NeuAc(2) | def | "DHex Hex(2) HexNAc(4) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=4&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1754] | xref | record_id "1754" | xref | delta_mono_mass "1864.67188" | xref | delta_avge_mass "1865.7016" | xref | delta_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1865_mono_mass "1864.67188" | xref | spec_1_neutral_loss_1865_avge_mass "1865.7016" | xref | spec_1_neutral_loss_1865_flag "false" | xref | spec_1_neutral_loss_1865_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1865_mono_mass "1864.67188" | xref | spec_1_neutral_loss_1865_avge_mass "1865.7016" | xref | spec_1_neutral_loss_1865_flag "false" | xref | spec_1_neutral_loss_1865_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1755] === UNIMOD:1755 Hex(1)HexNAc(1)NeuGc(5) |
null .Term [UNIMOD:1755] [cols="2*"] |
| id | UNIMOD:1755 | name | Hex(1)HexNAc(1)NeuGc(5) | def | "Hex HexNAc NeuGc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1755] | xref | record_id "1755" | xref | delta_mono_mass "1900.583852" | xref | delta_avge_mass "1901.603" | xref | delta_composition "Hex(1) HexNAc(1) NeuGc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1901_mono_mass "1900.583852" | xref | spec_1_neutral_loss_1901_avge_mass "1901.603" | xref | spec_1_neutral_loss_1901_flag "false" | xref | spec_1_neutral_loss_1901_composition "Hex(1) HexNAc(1) NeuGc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1901_mono_mass "1900.583852" | xref | spec_1_neutral_loss_1901_avge_mass "1901.603" | xref | spec_1_neutral_loss_1901_flag "false" | xref | spec_1_neutral_loss_1901_composition "Hex(1) HexNAc(1) NeuGc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1756] === UNIMOD:1756 Hex(4)HexNAc(4)NeuAc(1)Sulf(2) |
null .Term [UNIMOD:1756] [cols="2*"] |
| id | UNIMOD:1756 | name | Hex(4)HexNAc(4)NeuAc(1)Sulf(2) | def | "Hex(4) HexNAc(4) NeuAc Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1756] | xref | record_id "1756" | xref | delta_mono_mass "1911.53783" | xref | delta_avge_mass "1912.7135" | xref | delta_composition "O(6) S(2) Hex(4) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:50:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1912_mono_mass "1911.53783" | xref | spec_1_neutral_loss_1912_avge_mass "1912.7135" | xref | spec_1_neutral_loss_1912_flag "false" | xref | spec_1_neutral_loss_1912_composition "O(6) S(2) Hex(4) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1912_mono_mass "1911.53783" | xref | spec_1_neutral_loss_1912_avge_mass "1912.7135" | xref | spec_1_neutral_loss_1912_flag "false" | xref | spec_1_neutral_loss_1912_composition "O(6) S(2) Hex(4) HexNAc(4) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1757] === UNIMOD:1757 Hex(4)HexNAc(4)NeuGc(1)Sulf(2) |
null .Term [UNIMOD:1757] [cols="2*"] |
| id | UNIMOD:1757 | name | Hex(4)HexNAc(4)NeuGc(1)Sulf(2) | def | "Hex(4) HexNAc(4) NeuGc Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&hex=4&hexnac=4&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1757] | xref | record_id "1757" | xref | delta_mono_mass "1927.532745" | xref | delta_avge_mass "1928.7129" | xref | delta_composition "O(6) S(2) Hex(4) HexNAc(4) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:50:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1928_mono_mass "1927.532745" | xref | spec_1_neutral_loss_1928_avge_mass "1928.7129" | xref | spec_1_neutral_loss_1928_flag "false" | xref | spec_1_neutral_loss_1928_composition "O(6) S(2) Hex(4) HexNAc(4) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1928_mono_mass "1927.532745" | xref | spec_1_neutral_loss_1928_avge_mass "1928.7129" | xref | spec_1_neutral_loss_1928_flag "false" | xref | spec_1_neutral_loss_1928_composition "O(6) S(2) Hex(4) HexNAc(4) NeuGc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1758] === UNIMOD:1758 dHex(2)Hex(3)HexNAc(3)NeuAc(2) |
null .Term [UNIMOD:1758] [cols="2*"] |
| id | UNIMOD:1758 | name | dHex(2)Hex(3)HexNAc(3)NeuAc(2) | def | "DHex(2) Hex(3) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1758] | xref | record_id "1758" | xref | delta_mono_mass "1969.703239" | xref | delta_avge_mass "1970.7909" | xref | delta_composition "dHex(2) Hex(3) HexNAc(3) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1970_mono_mass "1969.703239" | xref | spec_1_neutral_loss_1970_avge_mass "1970.7909" | xref | spec_1_neutral_loss_1970_flag "false" | xref | spec_1_neutral_loss_1970_composition "dHex(2) Hex(3) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1970_mono_mass "1969.703239" | xref | spec_1_neutral_loss_1970_avge_mass "1970.7909" | xref | spec_1_neutral_loss_1970_flag "false" | xref | spec_1_neutral_loss_1970_composition "dHex(2) Hex(3) HexNAc(3) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1759] === UNIMOD:1759 Hex(4)HexNAc(4)NeuAc(1)Sulf(3) |
null .Term [UNIMOD:1759] [cols="2*"] |
| id | UNIMOD:1759 | name | Hex(4)HexNAc(4)NeuAc(1)Sulf(3) | def | "Hex(4) HexNAc(4) NeuAc Sulf(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=3&hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1759] | xref | record_id "1759" | xref | delta_mono_mass "1991.494645" | xref | delta_avge_mass "1992.7767" | xref | delta_composition "O(9) S(3) Hex(4) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:50:03" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1992_mono_mass "1991.494645" | xref | spec_1_neutral_loss_1992_avge_mass "1992.7767" | xref | spec_1_neutral_loss_1992_flag "false" | xref | spec_1_neutral_loss_1992_composition "O(9) S(3) Hex(4) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1992_mono_mass "1991.494645" | xref | spec_1_neutral_loss_1992_avge_mass "1992.7767" | xref | spec_1_neutral_loss_1992_flag "false" | xref | spec_1_neutral_loss_1992_composition "O(9) S(3) Hex(4) HexNAc(4) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1760] === UNIMOD:1760 dHex(2)Hex(2)HexNAc(2) |
null .Term [UNIMOD:1760] [cols="2*"] |
| id | UNIMOD:1760 | name | dHex(2)Hex(2)HexNAc(2) | def | "DHex(2) Hex(2) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1760] | xref | record_id "1760" | xref | delta_mono_mass "1022.38021" | xref | delta_avge_mass "1022.9486" | xref | delta_composition "dHex(2) Hex(2) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1023_mono_mass "1022.38021" | xref | spec_1_neutral_loss_1023_avge_mass "1022.9486" | xref | spec_1_neutral_loss_1023_flag "false" | xref | spec_1_neutral_loss_1023_composition "dHex(2) Hex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1023_mono_mass "1022.38021" | xref | spec_1_neutral_loss_1023_avge_mass "1022.9486" | xref | spec_1_neutral_loss_1023_flag "false" | xref | spec_1_neutral_loss_1023_composition "dHex(2) Hex(2) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1023_mono_mass "1022.38021" | xref | spec_2_neutral_loss_1023_avge_mass "1022.9486" | xref | spec_2_neutral_loss_1023_flag "false" | xref | spec_2_neutral_loss_1023_composition "dHex(2) Hex(2) HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1761] === UNIMOD:1761 dHex(1)Hex(3)HexNAc(2) |
null .Term [UNIMOD:1761] [cols="2*"] |
| id | UNIMOD:1761 | name | dHex(1)Hex(3)HexNAc(2) | def | "DHex Hex(3) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1761] | xref | record_id "1761" | xref | delta_mono_mass "1038.375125" | xref | delta_avge_mass "1038.948" | xref | delta_composition "dHex(1) Hex(3) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1039_mono_mass "1038.375125" | xref | spec_1_neutral_loss_1039_avge_mass "1038.948" | xref | spec_1_neutral_loss_1039_flag "false" | xref | spec_1_neutral_loss_1039_composition "dHex(1) Hex(3) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1039_mono_mass "1038.375125" | xref | spec_1_neutral_loss_1039_avge_mass "1038.948" | xref | spec_1_neutral_loss_1039_flag "false" | xref | spec_1_neutral_loss_1039_composition "dHex(1) Hex(3) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1039_mono_mass "1038.375125" | xref | spec_2_neutral_loss_1039_avge_mass "1038.948" | xref | spec_2_neutral_loss_1039_flag "false" | xref | spec_2_neutral_loss_1039_composition "dHex(1) Hex(3) HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1762] === UNIMOD:1762 dHex(1)Hex(2)HexNAc(3) |
null .Term [UNIMOD:1762] [cols="2*"] |
| id | UNIMOD:1762 | name | dHex(1)Hex(2)HexNAc(3) | def | "DHex Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1762] | xref | record_id "1762" | xref | delta_mono_mass "1079.401674" | xref | delta_avge_mass "1080" | xref | delta_composition "dHex(1) Hex(2) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1080_mono_mass "1079.401674" | xref | spec_1_neutral_loss_1080_avge_mass "1080" | xref | spec_1_neutral_loss_1080_flag "false" | xref | spec_1_neutral_loss_1080_composition "dHex(1) Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1080_mono_mass "1079.401674" | xref | spec_1_neutral_loss_1080_avge_mass "1080" | xref | spec_1_neutral_loss_1080_flag "false" | xref | spec_1_neutral_loss_1080_composition "dHex(1) Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1080_mono_mass "1079.401674" | xref | spec_2_neutral_loss_1080_avge_mass "1080" | xref | spec_2_neutral_loss_1080_flag "false" | xref | spec_2_neutral_loss_1080_composition "dHex(1) Hex(2) HexNAc(3)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1763] === UNIMOD:1763 Hex(3)HexNAc(3) |
null .Term [UNIMOD:1763] [cols="2*"] |
| id | UNIMOD:1763 | name | Hex(3)HexNAc(3) | def | "Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1763] | xref | record_id "1763" | xref | delta_mono_mass "1095.396588" | xref | delta_avge_mass "1095.9994" | xref | delta_composition "Hex(3) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1096_mono_mass "1095.396588" | xref | spec_1_neutral_loss_1096_avge_mass "1095.9994" | xref | spec_1_neutral_loss_1096_flag "false" | xref | spec_1_neutral_loss_1096_composition "Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1096_mono_mass "1095.396588" | xref | spec_1_neutral_loss_1096_avge_mass "1095.9994" | xref | spec_1_neutral_loss_1096_flag "false" | xref | spec_1_neutral_loss_1096_composition "Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1096_mono_mass "1095.396588" | xref | spec_2_neutral_loss_1096_avge_mass "1095.9994" | xref | spec_2_neutral_loss_1096_flag "false" | xref | spec_2_neutral_loss_1096_composition "Hex(3) HexNAc(3)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1764] === UNIMOD:1764 dHex(1)Hex(3)HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1764] [cols="2*"] |
| id | UNIMOD:1764 | name | dHex(1)Hex(3)HexNAc(2)Sulf(1) | def | "DHex Hex(3) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1764] | xref | record_id "1764" | xref | delta_mono_mass "1118.331939" | xref | delta_avge_mass "1119.0112" | xref | delta_composition "O(3) S dHex Hex(3) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-06 09:49:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1119_mono_mass "1118.331939" | xref | spec_1_neutral_loss_1119_avge_mass "1119.0112" | xref | spec_1_neutral_loss_1119_flag "false" | xref | spec_1_neutral_loss_1119_composition "O(3) S dHex Hex(3) HexNAc(2)" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1119_mono_mass "1118.331939" | xref | spec_1_neutral_loss_1119_avge_mass "1119.0112" | xref | spec_1_neutral_loss_1119_flag "false" | xref | spec_1_neutral_loss_1119_composition "O(3) S dHex Hex(3) HexNAc(2)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1119_mono_mass "1118.331939" | xref | spec_2_neutral_loss_1119_avge_mass "1119.0112" | xref | spec_2_neutral_loss_1119_flag "false" | xref | spec_2_neutral_loss_1119_composition "O(3) S dHex Hex(3) HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1765] === UNIMOD:1765 dHex(2)Hex(3)HexNAc(2) |
null .Term [UNIMOD:1765] [cols="2*"] |
| id | UNIMOD:1765 | name | dHex(2)Hex(3)HexNAc(2) | def | "DHex(2) Hex(3) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1765] | xref | record_id "1765" | xref | delta_mono_mass "1184.433033" | xref | delta_avge_mass "1185.0892" | xref | delta_composition "dHex(2) Hex(3) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1185_mono_mass "1184.433033" | xref | spec_1_neutral_loss_1185_avge_mass "1185.0892" | xref | spec_1_neutral_loss_1185_flag "false" | xref | spec_1_neutral_loss_1185_composition "dHex(2) Hex(3) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1185_mono_mass "1184.433033" | xref | spec_1_neutral_loss_1185_avge_mass "1185.0892" | xref | spec_1_neutral_loss_1185_flag "false" | xref | spec_1_neutral_loss_1185_composition "dHex(2) Hex(3) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1185_mono_mass "1184.433033" | xref | spec_2_neutral_loss_1185_avge_mass "1185.0892" | xref | spec_2_neutral_loss_1185_flag "false" | xref | spec_2_neutral_loss_1185_composition "dHex(2) Hex(3) HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1766] === UNIMOD:1766 dHex(1)Hex(4)HexNAc(2) |
null .Term [UNIMOD:1766] [cols="2*"] |
| id | UNIMOD:1766 | name | dHex(1)Hex(4)HexNAc(2) | def | "DHex Hex(4) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexac=2&mode=exact, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1766] | xref | record_id "1766" | xref | delta_mono_mass "1200.427948" | xref | delta_avge_mass "1201.0886" | xref | delta_composition "dHex(1) Hex(4) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1201_mono_mass "1200.427948" | xref | spec_1_neutral_loss_1201_avge_mass "1201.0886" | xref | spec_1_neutral_loss_1201_flag "false" | xref | spec_1_neutral_loss_1201_composition "dHex(1) Hex(4) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1201_mono_mass "1200.427948" | xref | spec_1_neutral_loss_1201_avge_mass "1201.0886" | xref | spec_1_neutral_loss_1201_flag "false" | xref | spec_1_neutral_loss_1201_composition "dHex(1) Hex(4) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1201_mono_mass "1200.427948" | xref | spec_2_neutral_loss_1201_avge_mass "1201.0886" | xref | spec_2_neutral_loss_1201_flag "false" | xref | spec_2_neutral_loss_1201_composition "dHex(1) Hex(4) HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1767] === UNIMOD:1767 dHex(2)Hex(2)HexNAc(3) |
null .Term [UNIMOD:1767] [cols="2*"] |
| id | UNIMOD:1767 | name | dHex(2)Hex(2)HexNAc(3) | def | "DHex(2) Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1767] | xref | record_id "1767" | xref | delta_mono_mass "1225.459583" | xref | delta_avge_mass "1226.1412" | xref | delta_composition "dHex(2) Hex(2) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1226_mono_mass "1225.459583" | xref | spec_1_neutral_loss_1226_avge_mass "1226.1412" | xref | spec_1_neutral_loss_1226_flag "false" | xref | spec_1_neutral_loss_1226_composition "dHex(2) Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1226_mono_mass "1225.459583" | xref | spec_1_neutral_loss_1226_avge_mass "1226.1412" | xref | spec_1_neutral_loss_1226_flag "false" | xref | spec_1_neutral_loss_1226_composition "dHex(2) Hex(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1226_mono_mass "1225.459583" | xref | spec_2_neutral_loss_1226_avge_mass "1226.1412" | xref | spec_2_neutral_loss_1226_flag "false" | xref | spec_2_neutral_loss_1226_composition "dHex(2) Hex(2) HexNAc(3)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1768] === UNIMOD:1768 dHex(1)Hex(3)HexNAc(3) |
null .Term [UNIMOD:1768] [cols="2*"] |
| id | UNIMOD:1768 | name | dHex(1)Hex(3)HexNAc(3) | def | "DHex Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1768] | xref | record_id "1768" | xref | delta_mono_mass "1241.454497" | xref | delta_avge_mass "1242.1406" | xref | delta_composition "dHex(1) Hex(3) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1242_mono_mass "1241.454497" | xref | spec_1_neutral_loss_1242_avge_mass "1242.1406" | xref | spec_1_neutral_loss_1242_flag "false" | xref | spec_1_neutral_loss_1242_composition "dHex(1) Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1242_mono_mass "1241.454497" | xref | spec_1_neutral_loss_1242_avge_mass "1242.1406" | xref | spec_1_neutral_loss_1242_flag "false" | xref | spec_1_neutral_loss_1242_composition "dHex(1) Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1242_mono_mass "1241.454497" | xref | spec_2_neutral_loss_1242_avge_mass "1242.1406" | xref | spec_2_neutral_loss_1242_flag "false" | xref | spec_2_neutral_loss_1242_composition "dHex(1) Hex(3) HexNAc(3)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1769] === UNIMOD:1769 Hex(4)HexNAc(3) |
null .Term [UNIMOD:1769] [cols="2*"] |
| id | UNIMOD:1769 | name | Hex(4)HexNAc(3) | def | "Hex(4) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1769] | xref | record_id "1769" | xref | delta_mono_mass "1257.449412" | xref | delta_avge_mass "1258.14" | xref | delta_composition "Hex(4) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1258_mono_mass "1257.449412" | xref | spec_1_neutral_loss_1258_avge_mass "1258.14" | xref | spec_1_neutral_loss_1258_flag "false" | xref | spec_1_neutral_loss_1258_composition "Hex(4) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1258_mono_mass "1257.449412" | xref | spec_1_neutral_loss_1258_avge_mass "1258.14" | xref | spec_1_neutral_loss_1258_flag "false" | xref | spec_1_neutral_loss_1258_composition "Hex(4) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1258_mono_mass "1257.449412" | xref | spec_2_neutral_loss_1258_avge_mass "1258.14" | xref | spec_2_neutral_loss_1258_flag "false" | xref | spec_2_neutral_loss_1258_composition "Hex(4) HexNAc(3)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1770] === UNIMOD:1770 dHex(2)Hex(4)HexNAc(2) |
null .Term [UNIMOD:1770] [cols="2*"] |
| id | UNIMOD:1770 | name | dHex(2)Hex(4)HexNAc(2) | def | "DHex(2) Hex(4) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1770] | xref | record_id "1770" | xref | delta_mono_mass "1346.485857" | xref | delta_avge_mass "1347.2298" | xref | delta_composition "dHex(2) Hex(4) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1347_mono_mass "1346.485857" | xref | spec_1_neutral_loss_1347_avge_mass "1347.2298" | xref | spec_1_neutral_loss_1347_flag "false" | xref | spec_1_neutral_loss_1347_composition "dHex(2) Hex(4) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1347_mono_mass "1346.485857" | xref | spec_1_neutral_loss_1347_avge_mass "1347.2298" | xref | spec_1_neutral_loss_1347_flag "false" | xref | spec_1_neutral_loss_1347_composition "dHex(2) Hex(4) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1347_mono_mass "1346.485857" | xref | spec_2_neutral_loss_1347_avge_mass "1347.2298" | xref | spec_2_neutral_loss_1347_flag "false" | xref | spec_2_neutral_loss_1347_composition "dHex(2) Hex(4) HexNAc(2)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1771] === UNIMOD:1771 dHex(2)Hex(3)HexNAc(3) |
null .Term [UNIMOD:1771] [cols="2*"] |
| id | UNIMOD:1771 | name | dHex(2)Hex(3)HexNAc(3) | def | "DHex(2) Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1771] | xref | record_id "1771" | xref | delta_mono_mass "1387.512406" | xref | delta_avge_mass "1388.2818" | xref | delta_composition "dHex(2) Hex(3) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1388_mono_mass "1387.512406" | xref | spec_1_neutral_loss_1388_avge_mass "1388.2818" | xref | spec_1_neutral_loss_1388_flag "false" | xref | spec_1_neutral_loss_1388_composition "dHex(2) Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1388_mono_mass "1387.512406" | xref | spec_1_neutral_loss_1388_avge_mass "1388.2818" | xref | spec_1_neutral_loss_1388_flag "false" | xref | spec_1_neutral_loss_1388_composition "dHex(2) Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1388_mono_mass "1387.512406" | xref | spec_2_neutral_loss_1388_avge_mass "1388.2818" | xref | spec_2_neutral_loss_1388_flag "false" | xref | spec_2_neutral_loss_1388_composition "dHex(2) Hex(3) HexNAc(3)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1772] === UNIMOD:1772 Hex(3)HexNAc(5) |
null .Term [UNIMOD:1772] [cols="2*"] |
| id | UNIMOD:1772 | name | Hex(3)HexNAc(5) | def | "Hex(3) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1772] | xref | record_id "1772" | xref | delta_mono_mass "1501.555334" | xref | delta_avge_mass "1502.3844" | xref | delta_composition "Hex(3) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1502_mono_mass "1501.555334" | xref | spec_1_neutral_loss_1502_avge_mass "1502.3844" | xref | spec_1_neutral_loss_1502_flag "false" | xref | spec_1_neutral_loss_1502_composition "Hex(3) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1502_mono_mass "1501.555334" | xref | spec_1_neutral_loss_1502_avge_mass "1502.3844" | xref | spec_1_neutral_loss_1502_flag "false" | xref | spec_1_neutral_loss_1502_composition "Hex(3) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1502_mono_mass "1501.555334" | xref | spec_2_neutral_loss_1502_avge_mass "1502.3844" | xref | spec_2_neutral_loss_1502_flag "false" | xref | spec_2_neutral_loss_1502_composition "Hex(3) HexNAc(5)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1773] === UNIMOD:1773 Hex(4)HexNAc(3)NeuAc(1) |
null .Term [UNIMOD:1773] [cols="2*"] |
| id | UNIMOD:1773 | name | Hex(4)HexNAc(3)NeuAc(1) | def | "Hex(4) HexNAc(3) NeuAc ---OR--- Hex(3) HexNAc(4) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1773] | xref | record_id "1773" | xref | delta_mono_mass "1548.544828" | xref | delta_avge_mass "1549.3945" | xref | delta_composition "Hex(4) HexNAc(3) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-17 15:42:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1549_mono_mass "1548.544828" | xref | spec_1_neutral_loss_1549_avge_mass "1549.3945" | xref | spec_1_neutral_loss_1549_flag "false" | xref | spec_1_neutral_loss_1549_composition "Hex(4) HexNAc(3) NeuAc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1549_mono_mass "1548.544828" | xref | spec_1_neutral_loss_1549_avge_mass "1549.3945" | xref | spec_1_neutral_loss_1549_flag "false" | xref | spec_1_neutral_loss_1549_composition "Hex(4) HexNAc(3) NeuAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1549_mono_mass "1548.544828" | xref | spec_2_neutral_loss_1549_avge_mass "1549.3945" | xref | spec_2_neutral_loss_1549_flag "false" | xref | spec_2_neutral_loss_1549_composition "Hex(4) HexNAc(3) NeuAc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1774] === UNIMOD:1774 dHex(2)Hex(3)HexNAc(4) |
null .Term [UNIMOD:1774] [cols="2*"] |
| id | UNIMOD:1774 | name | dHex(2)Hex(3)HexNAc(4) | def | "DHex(2) Hex(3) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1774] | xref | record_id "1774" | xref | delta_mono_mass "1590.591779" | xref | delta_avge_mass "1591.4743" | xref | delta_composition "dHex(2) Hex(3) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1591_mono_mass "1590.591779" | xref | spec_1_neutral_loss_1591_avge_mass "1591.4743" | xref | spec_1_neutral_loss_1591_flag "false" | xref | spec_1_neutral_loss_1591_composition "dHex(2) Hex(3) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1591_mono_mass "1590.591779" | xref | spec_1_neutral_loss_1591_avge_mass "1591.4743" | xref | spec_1_neutral_loss_1591_flag "false" | xref | spec_1_neutral_loss_1591_composition "dHex(2) Hex(3) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1591_mono_mass "1590.591779" | xref | spec_2_neutral_loss_1591_avge_mass "1591.4743" | xref | spec_2_neutral_loss_1591_flag "false" | xref | spec_2_neutral_loss_1591_composition "dHex(2) Hex(3) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1775] === UNIMOD:1775 dHex(1)Hex(3)HexNAc(5) |
null .Term [UNIMOD:1775] [cols="2*"] |
| id | UNIMOD:1775 | name | dHex(1)Hex(3)HexNAc(5) | def | "DHex Hex(3) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1775] | xref | record_id "1775" | xref | delta_mono_mass "1647.613242" | xref | delta_avge_mass "1648.5256" | xref | delta_composition "dHex(1) Hex(3) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1648_mono_mass "1647.613242" | xref | spec_1_neutral_loss_1648_avge_mass "1648.5256" | xref | spec_1_neutral_loss_1648_flag "false" | xref | spec_1_neutral_loss_1648_composition "dHex(1) Hex(3) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1648_mono_mass "1647.613242" | xref | spec_1_neutral_loss_1648_avge_mass "1648.5256" | xref | spec_1_neutral_loss_1648_flag "false" | xref | spec_1_neutral_loss_1648_composition "dHex(1) Hex(3) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1648_mono_mass "1647.613242" | xref | spec_2_neutral_loss_1648_avge_mass "1648.5256" | xref | spec_2_neutral_loss_1648_flag "false" | xref | spec_2_neutral_loss_1648_composition "dHex(1) Hex(3) HexNAc(5)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1776] === UNIMOD:1776 Hex(3)HexNAc(6) |
null .Term [UNIMOD:1776] [cols="2*"] |
| id | UNIMOD:1776 | name | Hex(3)HexNAc(6) | def | "Hex(3) HexNAc(6)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1776] | xref | record_id "1776" | xref | delta_mono_mass "1704.634706" | xref | delta_avge_mass "1705.5769" | xref | delta_composition "Hex(3) HexNAc(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1705_mono_mass "1704.634706" | xref | spec_1_neutral_loss_1705_avge_mass "1705.5769" | xref | spec_1_neutral_loss_1705_flag "false" | xref | spec_1_neutral_loss_1705_composition "Hex(3) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1705_mono_mass "1704.634706" | xref | spec_1_neutral_loss_1705_avge_mass "1705.5769" | xref | spec_1_neutral_loss_1705_flag "false" | xref | spec_1_neutral_loss_1705_composition "Hex(3) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1705_mono_mass "1704.634706" | xref | spec_2_neutral_loss_1705_avge_mass "1705.5769" | xref | spec_2_neutral_loss_1705_flag "false" | xref | spec_2_neutral_loss_1705_composition "Hex(3) HexNAc(6)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1777] === UNIMOD:1777 Hex(4)HexNAc(4)NeuAc(1) |
null .Term [UNIMOD:1777] [cols="2*"] |
| id | UNIMOD:1777 | name | Hex(4)HexNAc(4)NeuAc(1) | def | "Hex(4) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1777] | xref | record_id "1777" | xref | delta_mono_mass "1751.624201" | xref | delta_avge_mass "1752.5871" | xref | delta_composition "Hex(4) HexNAc(4) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1752_mono_mass "1751.624201" | xref | spec_1_neutral_loss_1752_avge_mass "1752.5871" | xref | spec_1_neutral_loss_1752_flag "false" | xref | spec_1_neutral_loss_1752_composition "Hex(4) HexNAc(4) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1752_mono_mass "1751.624201" | xref | spec_1_neutral_loss_1752_avge_mass "1752.5871" | xref | spec_1_neutral_loss_1752_flag "false" | xref | spec_1_neutral_loss_1752_composition "Hex(4) HexNAc(4) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1752_mono_mass "1751.624201" | xref | spec_2_neutral_loss_1752_avge_mass "1752.5871" | xref | spec_2_neutral_loss_1752_flag "false" | xref | spec_2_neutral_loss_1752_composition "Hex(4) HexNAc(4) NeuAc(1)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1778] === UNIMOD:1778 dHex(2)Hex(4)HexNAc(4) |
null .Term [UNIMOD:1778] [cols="2*"] |
| id | UNIMOD:1778 | name | dHex(2)Hex(4)HexNAc(4) | def | "DHex(2) Hex(4) HexNAc(4) ---OR--- Hex(4) HexNAc(4) dHex Pent Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1778] | xref | record_id "1778" | xref | delta_mono_mass "1752.644602" | xref | delta_avge_mass "1753.6149" | xref | delta_composition "dHex(2) Hex(4) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-22 11:07:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1753_mono_mass "1752.644602" | xref | spec_1_neutral_loss_1753_avge_mass "1753.6149" | xref | spec_1_neutral_loss_1753_flag "false" | xref | spec_1_neutral_loss_1753_composition "dHex(2) Hex(4) HexNAc(4)" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1753_mono_mass "1752.644602" | xref | spec_1_neutral_loss_1753_avge_mass "1753.6149" | xref | spec_1_neutral_loss_1753_flag "false" | xref | spec_1_neutral_loss_1753_composition "dHex(2) Hex(4) HexNAc(4)" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1753_mono_mass "1752.644602" | xref | spec_2_neutral_loss_1753_avge_mass "1753.6149" | xref | spec_2_neutral_loss_1753_flag "false" | xref | spec_2_neutral_loss_1753_composition "dHex(2) Hex(4) HexNAc(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1779] === UNIMOD:1779 Hex(6)HexNAc(4) |
null .Term [UNIMOD:1779] [cols="2*"] |
| id | UNIMOD:1779 | name | Hex(6)HexNAc(4) | def | "Hex(6) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1779] | xref | record_id "1779" | xref | delta_mono_mass "1784.634431" | xref | delta_avge_mass "1785.6137" | xref | delta_composition "Hex(6) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1785_mono_mass "1784.634431" | xref | spec_1_neutral_loss_1785_avge_mass "1785.6137" | xref | spec_1_neutral_loss_1785_flag "false" | xref | spec_1_neutral_loss_1785_composition "Hex(6) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1785_mono_mass "1784.634431" | xref | spec_1_neutral_loss_1785_avge_mass "1785.6137" | xref | spec_1_neutral_loss_1785_flag "false" | xref | spec_1_neutral_loss_1785_composition "Hex(6) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1785_mono_mass "1784.634431" | xref | spec_2_neutral_loss_1785_avge_mass "1785.6137" | xref | spec_2_neutral_loss_1785_flag "false" | xref | spec_2_neutral_loss_1785_composition "Hex(6) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1780] === UNIMOD:1780 Hex(5)HexNAc(5) |
null .Term [UNIMOD:1780] [cols="2*"] |
| id | UNIMOD:1780 | name | Hex(5)HexNAc(5) | def | "Hex(5) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1780] | xref | record_id "1780" | xref | delta_mono_mass "1825.660981" | xref | delta_avge_mass "1826.6656" | xref | delta_composition "Hex(5) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1826_mono_mass "1825.660981" | xref | spec_1_neutral_loss_1826_avge_mass "1826.6656" | xref | spec_1_neutral_loss_1826_flag "false" | xref | spec_1_neutral_loss_1826_composition "Hex(5) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1826_mono_mass "1825.660981" | xref | spec_1_neutral_loss_1826_avge_mass "1826.6656" | xref | spec_1_neutral_loss_1826_flag "false" | xref | spec_1_neutral_loss_1826_composition "Hex(5) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1826_mono_mass "1825.660981" | xref | spec_2_neutral_loss_1826_avge_mass "1826.6656" | xref | spec_2_neutral_loss_1826_flag "false" | xref | spec_2_neutral_loss_1826_composition "Hex(5) HexNAc(5)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1781] === UNIMOD:1781 dHex(1)Hex(3)HexNAc(6) |
null .Term [UNIMOD:1781] [cols="2*"] |
| id | UNIMOD:1781 | name | dHex(1)Hex(3)HexNAc(6) | def | "DHex Hex(3) HexNAc(6)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1781] | xref | record_id "1781" | xref | delta_mono_mass "1850.692615" | xref | delta_avge_mass "1851.7181" | xref | delta_composition "dHex(1) Hex(3) HexNAc(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1851_mono_mass "1850.692615" | xref | spec_1_neutral_loss_1851_avge_mass "1851.7181" | xref | spec_1_neutral_loss_1851_flag "false" | xref | spec_1_neutral_loss_1851_composition "dHex(1) Hex(3) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1851_mono_mass "1850.692615" | xref | spec_1_neutral_loss_1851_avge_mass "1851.7181" | xref | spec_1_neutral_loss_1851_flag "false" | xref | spec_1_neutral_loss_1851_composition "dHex(1) Hex(3) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1851_mono_mass "1850.692615" | xref | spec_2_neutral_loss_1851_avge_mass "1851.7181" | xref | spec_2_neutral_loss_1851_flag "false" | xref | spec_2_neutral_loss_1851_composition "dHex(1) Hex(3) HexNAc(6)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1782] === UNIMOD:1782 dHex(1)Hex(4)HexNAc(4)NeuAc(1) |
null .Term [UNIMOD:1782] [cols="2*"] |
| id | UNIMOD:1782 | name | dHex(1)Hex(4)HexNAc(4)NeuAc(1) | def | "DHex Hex(4) HexNAc(4) NeuAc ---OR--- Hex(3) HexNAc(5) dHex Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1782] | xref | record_id "1782" | xref | delta_mono_mass "1897.68211" | xref | delta_avge_mass "1898.7283" | xref | delta_composition "dHex Hex(4) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2017-11-22 11:17:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1898_mono_mass "1897.68211" | xref | spec_1_neutral_loss_1898_avge_mass "1898.7283" | xref | spec_1_neutral_loss_1898_flag "false" | xref | spec_1_neutral_loss_1898_composition "dHex Hex(4) HexNAc(4) NeuAc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1898_mono_mass "1897.68211" | xref | spec_1_neutral_loss_1898_avge_mass "1898.7283" | xref | spec_1_neutral_loss_1898_flag "false" | xref | spec_1_neutral_loss_1898_composition "dHex Hex(4) HexNAc(4) NeuAc" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_1898_mono_mass "1897.68211" | xref | spec_2_neutral_loss_1898_avge_mass "1898.7283" | xref | spec_2_neutral_loss_1898_flag "false" | xref | spec_2_neutral_loss_1898_composition "dHex Hex(4) HexNAc(4) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1783] === UNIMOD:1783 dHex(3)Hex(4)HexNAc(4) |
null .Term [UNIMOD:1783] [cols="2*"] |
| id | UNIMOD:1783 | name | dHex(3)Hex(4)HexNAc(4) | def | "DHex(3) Hex(4) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1783] | xref | record_id "1783" | xref | delta_mono_mass "1898.702511" | xref | delta_avge_mass "1899.7561" | xref | delta_composition "dHex(3) Hex(4) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1899_mono_mass "1898.702511" | xref | spec_1_neutral_loss_1899_avge_mass "1899.7561" | xref | spec_1_neutral_loss_1899_flag "false" | xref | spec_1_neutral_loss_1899_composition "dHex(3) Hex(4) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1899_mono_mass "1898.702511" | xref | spec_1_neutral_loss_1899_avge_mass "1899.7561" | xref | spec_1_neutral_loss_1899_flag "false" | xref | spec_1_neutral_loss_1899_composition "dHex(3) Hex(4) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1899_mono_mass "1898.702511" | xref | spec_2_neutral_loss_1899_avge_mass "1899.7561" | xref | spec_2_neutral_loss_1899_flag "false" | xref | spec_2_neutral_loss_1899_composition "dHex(3) Hex(4) HexNAc(4)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1784] === UNIMOD:1784 dHex(1)Hex(3)HexNAc(5)NeuAc(1) |
null .Term [UNIMOD:1784] [cols="2*"] |
| id | UNIMOD:1784 | name | dHex(1)Hex(3)HexNAc(5)NeuAc(1) | def | "DHex Hex(3) HexNAc(5) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=5&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1784] | xref | record_id "1784" | xref | delta_mono_mass "1938.708659" | xref | delta_avge_mass "1939.7802" | xref | delta_composition "dHex(1) Hex(3) HexNAc(5) NeuAc(1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1939_mono_mass "1938.708659" | xref | spec_1_neutral_loss_1939_avge_mass "1939.7802" | xref | spec_1_neutral_loss_1939_flag "false" | xref | spec_1_neutral_loss_1939_composition "dHex(1) Hex(3) HexNAc(5) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1939_mono_mass "1938.708659" | xref | spec_1_neutral_loss_1939_avge_mass "1939.7802" | xref | spec_1_neutral_loss_1939_flag "false" | xref | spec_1_neutral_loss_1939_composition "dHex(1) Hex(3) HexNAc(5) NeuAc(1)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1939_mono_mass "1938.708659" | xref | spec_2_neutral_loss_1939_avge_mass "1939.7802" | xref | spec_2_neutral_loss_1939_flag "false" | xref | spec_2_neutral_loss_1939_composition "dHex(1) Hex(3) HexNAc(5) NeuAc(1)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1785] === UNIMOD:1785 dHex(2)Hex(4)HexNAc(5) |
null .Term [UNIMOD:1785] [cols="2*"] |
| id | UNIMOD:1785 | name | dHex(2)Hex(4)HexNAc(5) | def | "DHex(2) Hex(4) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1785] | xref | record_id "1785" | xref | delta_mono_mass "1955.723975" | xref | delta_avge_mass "1956.8074" | xref | delta_composition "dHex(2) Hex(4) HexNAc(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 12:00:00" | xref | date_time_modified "2015-05-05 12:00:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1956_mono_mass "1955.723975" | xref | spec_1_neutral_loss_1956_avge_mass "1956.8074" | xref | spec_1_neutral_loss_1956_flag "false" | xref | spec_1_neutral_loss_1956_composition "dHex(2) Hex(4) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1956_mono_mass "1955.723975" | xref | spec_1_neutral_loss_1956_avge_mass "1956.8074" | xref | spec_1_neutral_loss_1956_flag "false" | xref | spec_1_neutral_loss_1956_composition "dHex(2) Hex(4) HexNAc(5)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "N-linked glycosylation" | xref | spec_2_neutral_loss_1956_mono_mass "1955.723975" | xref | spec_2_neutral_loss_1956_avge_mass "1956.8074" | xref | spec_2_neutral_loss_1956_flag "false" | xref | spec_2_neutral_loss_1956_composition "dHex(2) Hex(4) HexNAc(5)" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1786] === UNIMOD:1786 Hex(1)HexNAc(1)NeuAc(1)Ac(1) |
null .Term [UNIMOD:1786] [cols="2*"] |
| id | UNIMOD:1786 | name | Hex(1)HexNAc(1)NeuAc(1)Ac(1) | def | "Ac Hex HexNAc NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=1&hex=1&hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1786] | xref | record_id "1786" | xref | delta_mono_mass "698.238177" | xref | delta_avge_mass "698.6244" | xref | delta_composition "Ac Hex HexNAc NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2015-05-05 16:37:35" | xref | date_time_modified "2015-05-06 09:37:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_699_mono_mass "698.238177" | xref | spec_1_neutral_loss_699_avge_mass "698.6244" | xref | spec_1_neutral_loss_699_flag "false" | xref | spec_1_neutral_loss_699_composition "Ac Hex HexNAc NeuAc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_699_mono_mass "698.238177" | xref | spec_1_neutral_loss_699_avge_mass "698.6244" | xref | spec_1_neutral_loss_699_flag "false" | xref | spec_1_neutral_loss_699_composition "Ac Hex HexNAc NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1787] === UNIMOD:1787 Label:13C(2)15N(2) |
null .Term [UNIMOD:1787] [cols="2*"] |
| id | UNIMOD:1787 | name | Label:13C(2)15N(2) | def | "13C(2) 15N(2)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1787] | comment | For SILAC experiments. | synonym | "K4" [] | xref | record_id "1787" | xref | delta_mono_mass "4.00078" | xref | delta_avge_mass "3.9721" | xref | delta_composition "C(-2) 13C(2) N(-2) 15N(2)" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2015-05-15 22:30:48" | xref | date_time_modified "2015-05-24 18:09:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1789] === UNIMOD:1789 X155 |
null .Term [UNIMOD:1789] [cols="2*"] |
| id | UNIMOD:1789 | name | X155 | def | "Ammonium-quenched monolink of DSS/BS3 crosslinker." [PMID:8326953, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1789] | xref | record_id "1789" | xref | delta_mono_mass "155.094629" | xref | delta_avge_mass "155.1943" | xref | delta_composition "H(13) C(8) N O(2)" | xref | username_of_poster "johant" | xref | group_of_poster "" | xref | date_time_posted "2015-06-17 14:35:50" | xref | date_time_modified "2017-08-17 15:09:42" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1799] === UNIMOD:1799 NQIGG |
null .Term [UNIMOD:1799] [cols="2*"] |
| id | UNIMOD:1799 | name | NQIGG | def | "SUMOylation by Giardia lamblia." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1799] | xref | record_id "1799" | xref | delta_mono_mass "469.228496" | xref | delta_avge_mass "469.4921" | xref | delta_composition "H(31) C(19) N(7) O(7)" | xref | username_of_poster "brunog" | xref | group_of_poster "" | xref | date_time_posted "2015-10-02 16:16:32" | xref | date_time_modified "2015-11-01 16:20:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1800] === UNIMOD:1800 Carboxyethylpyrrole |
null .Term [UNIMOD:1800] [cols="2*"] |
| id | UNIMOD:1800 | name | Carboxyethylpyrrole | def | "Carboxyethylpyrrole." [PMID:12923198, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1800] | xref | record_id "1800" | xref | delta_mono_mass "122.036779" | xref | delta_avge_mass "122.1213" | xref | delta_composition "H(6) C(7) O(2)" | xref | username_of_poster "jsc17" | xref | group_of_poster "" | xref | date_time_posted "2015-11-19 01:35:22" | xref | date_time_modified "2016-04-06 08:03:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1801] === UNIMOD:1801 Fluorescein-tyramine |
null .Term [UNIMOD:1801] [cols="2*"] |
| id | UNIMOD:1801 | name | Fluorescein-tyramine | def | "Fluorescein-tyramine adduct by peroxidase activity." [URL:http\://www.biosyn.com/tew/tyramide-signal-amplification.aspx, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1801] | xref | record_id "1801" | xref | delta_mono_mass "493.116152" | xref | delta_avge_mass "493.4637" | xref | delta_composition "H(19) C(29) N O(7)" | xref | username_of_poster "Hideaki" | xref | group_of_poster "" | xref | date_time_posted "2016-02-02 11:23:24" | xref | date_time_modified "2016-04-06 08:08:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1824] === UNIMOD:1824 GEE |
null .Term [UNIMOD:1824] [cols="2*"] |
| id | UNIMOD:1824 | name | GEE | def | "Transamidation of glycine ethyl ester to glutamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1824] | xref | record_id "1824" | xref | delta_mono_mass "86.036779" | xref | delta_avge_mass "86.0892" | xref | delta_composition "H(6) C(4) O(2)" | xref | username_of_poster "michaelmerchant" | xref | group_of_poster "" | xref | date_time_posted "2016-05-12 15:56:17" | xref | date_time_modified "2016-05-18 17:11:04" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_misc_notes "GEE (glycine ethyl ester) is a substrate for the enzyme Factor XIII for cross-linking to fibrinogen" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1825] === UNIMOD:1825 RNPXL |
null .Term [UNIMOD:1825] [cols="2*"] |
| id | UNIMOD:1825 | name | RNPXL | def | "Simulate peptide-RNA conjugates." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1825] | xref | record_id "1825" | xref | delta_mono_mass "324.035867" | xref | delta_avge_mass "324.1813" | xref | delta_composition "H(13) C(9) N(2) O(9) P" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-06-05 14:23:58" | xref | date_time_modified "2016-07-01 11:23:46" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Other" | xref | spec_1_neutral_loss_325_mono_mass "324.035867" | xref | spec_1_neutral_loss_325_avge_mass "324.1813" | xref | spec_1_neutral_loss_325_flag "false" | xref | spec_1_neutral_loss_325_composition "H(13) C(9) N(2) O(9) P" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "R" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Other" | xref | spec_2_neutral_loss_325_mono_mass "324.035867" | xref | spec_2_neutral_loss_325_avge_mass "324.1813" | xref | spec_2_neutral_loss_325_flag "false" | xref | spec_2_neutral_loss_325_composition "H(13) C(9) N(2) O(9) P" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1826] === UNIMOD:1826 Glu→pyro-Glu+Methyl |
null .Term [UNIMOD:1826] [cols="2*"] |
| id | UNIMOD:1826 | name | Glu→pyro-Glu+Methyl | def | "Pyro-Glu from E + Methylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1826] | xref | record_id "1826" | xref | delta_mono_mass "-3.994915" | xref | delta_avge_mass "-3.9887" | xref | delta_composition "C O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-06-15 10:07:50" | xref | date_time_modified "2016-06-15 10:07:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1827] === UNIMOD:1827 Glu→pyro-Glu+Methyl:2H(2)13C(1) |
null .Term [UNIMOD:1827] [cols="2*"] |
| id | UNIMOD:1827 | name | Glu→pyro-Glu+Methyl:2H(2)13C(1) | def | "Pyro-Glu from E + Methylation Medium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1827] | xref | record_id "1827" | xref | delta_mono_mass "-0.979006" | xref | delta_avge_mass "-0.9837" | xref | delta_composition "H(-2) 2H(2) 13C O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-06-15 10:30:37" | xref | date_time_modified "2016-06-15 10:30:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1828] === UNIMOD:1828 LRGG+methyl |
null .Term [UNIMOD:1828] [cols="2*"] |
| id | UNIMOD:1828 | name | LRGG+methyl | def | "LeumethylArgGlyGly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1828] | comment | LRGG remnant of ubiquitin remaining attached to lysine with missed cleavage due to methylation of arginine. | synonym | "LRGG ubiquitin remnant with methylated Arg" [] | xref | record_id "1828" | xref | delta_mono_mass "397.243753" | xref | delta_avge_mass "397.4725" | xref | delta_composition "H(31) C(17) N(7) O(4)" | xref | username_of_poster "bkatja" | xref | group_of_poster "" | xref | date_time_posted "2016-07-27 14:34:54" | xref | date_time_modified "2016-09-23 13:43:32" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1829] === UNIMOD:1829 LRGG+dimethyl |
null .Term [UNIMOD:1829] [cols="2*"] |
| id | UNIMOD:1829 | name | LRGG+dimethyl | def | "LeudimethylArgGlyGly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1829] | comment | LRGG remnant of ubiquitin remaining attached to lysine with missed cleavage due to dimethylation of arginine. | synonym | "LRGG ubiquitin remnant with dimethylated Arg" [] | xref | record_id "1829" | xref | delta_mono_mass "411.259403" | xref | delta_avge_mass "411.4991" | xref | delta_composition "H(33) C(18) N(7) O(4)" | xref | username_of_poster "bkatja" | xref | group_of_poster "" | xref | date_time_posted "2016-07-27 16:20:40" | xref | date_time_modified "2016-09-23 13:43:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1830] === UNIMOD:1830 Biotin-tyramide |
null .Term [UNIMOD:1830] [cols="2*"] |
| id | UNIMOD:1830 | name | Biotin-tyramide | def | "Biotin-Phenol." [URL:http\://www.iris-biotech.de/ls-3500, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1830] | xref | record_id "1830" | xref | delta_mono_mass "361.146012" | xref | delta_avge_mass "361.4585" | xref | delta_composition "H(23) C(18) N(3) O(3) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-08-04 08:05:43" | xref | date_time_modified "2016-08-04 08:05:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1831] === UNIMOD:1831 Tris |
null .Term [UNIMOD:1831] [cols="2*"] |
| id | UNIMOD:1831 | name | Tris | def | "Tris adduct causes 104 Da addition at asparagine-succinimide intermediate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1831] | synonym | "tris adduct at asparagine tris adduct at IgG causes 104 Da addition" [] | xref | record_id "1831" | xref | delta_mono_mass "104.071154" | xref | delta_avge_mass "104.1277" | xref | delta_composition "H(10) C(4) N O(2)" | xref | username_of_poster "pradeepnpraveen" | xref | group_of_poster "" | xref | date_time_posted "2016-08-04 12:54:25" | xref | date_time_modified "2016-09-23 13:48:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_misc_notes "NG sequence specifically after deamidation - Deamidated Asparagine with adjacent glycine are prone for this modification." | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1832] === UNIMOD:1832 IASD |
null .Term [UNIMOD:1832] [cols="2*"] |
| id | UNIMOD:1832 | name | IASD | def | "Iodoacetamide derivative of stilbene (reaction product with thiol)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1832] | synonym | "4-acetamido-4'-((iodoacetyl)amino)stilbene-2,2'-disulfonic acid" [] | xref | record_id "1832" | xref | delta_mono_mass "452.034807" | xref | delta_avge_mass "452.4582" | xref | delta_composition "H(16) C(18) N(2) O(8) S(2)" | xref | username_of_poster "AberdeenProteomics" | xref | group_of_poster "" | xref | date_time_posted "2016-08-05 12:04:02" | xref | date_time_modified "2016-09-23 13:49:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1833] === UNIMOD:1833 NP40 |
null .Term [UNIMOD:1833] [cols="2*"] |
| id | UNIMOD:1833 | name | NP40 | def | "NP-40 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1833] | xref | record_id "1833" | xref | delta_mono_mass "220.182715" | xref | delta_avge_mass "220.3505" | xref | delta_composition "H(24) C(15) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-08-22 14:48:48" | xref | date_time_modified "2016-08-22 16:07:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1834] === UNIMOD:1834 Tween20 |
null .Term [UNIMOD:1834] [cols="2*"] |
| id | UNIMOD:1834 | name | Tween20 | def | "Tween 20 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1834] | xref | record_id "1834" | xref | delta_mono_mass "165.164326" | xref | delta_avge_mass "165.2951" | xref | delta_composition "H(21) C(12)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-08-22 14:51:41" | xref | date_time_modified "2016-08-22 16:07:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1835] === UNIMOD:1835 Tween80 |
null .Term [UNIMOD:1835] [cols="2*"] |
| id | UNIMOD:1835 | name | Tween80 | def | "Tween 80 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1835] | xref | record_id "1835" | xref | delta_mono_mass "263.237491" | xref | delta_avge_mass "263.4381" | xref | delta_composition "H(31) C(18) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-08-22 14:52:52" | xref | date_time_modified "2016-08-22 16:08:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1836] === UNIMOD:1836 Triton |
null .Term [UNIMOD:1836] [cols="2*"] |
| id | UNIMOD:1836 | name | Triton | def | "Triton synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1836] | xref | record_id "1836" | xref | delta_mono_mass "188.156501" | xref | delta_avge_mass "188.3086" | xref | delta_composition "H(20) C(14)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-08-22 14:53:44" | xref | date_time_modified "2016-08-22 16:07:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "Triton X-100" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Other" | xref | spec_2_misc_notes "Triton X-114" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1837] === UNIMOD:1837 Brij35 |
null .Term [UNIMOD:1837] [cols="2*"] |
| id | UNIMOD:1837 | name | Brij35 | def | "Brij 35 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1837] | xref | record_id "1837" | xref | delta_mono_mass "168.187801" | xref | delta_avge_mass "168.319" | xref | delta_composition "H(24) C(12)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-08-22 14:55:48" | xref | date_time_modified "2016-08-22 16:07:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1838] === UNIMOD:1838 Brij58 |
null .Term [UNIMOD:1838] [cols="2*"] |
| id | UNIMOD:1838 | name | Brij58 | def | "Brij 58 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1838] | xref | record_id "1838" | xref | delta_mono_mass "224.250401" | xref | delta_avge_mass "224.4253" | xref | delta_composition "H(32) C(16)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-08-22 14:56:22" | xref | date_time_modified "2016-08-22 16:08:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Other" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1839] === UNIMOD:1839 betaFNA |
null .Term [UNIMOD:1839] [cols="2*"] |
| id | UNIMOD:1839 | name | betaFNA | def | "Beta-Funaltrexamine." [PMID:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3523197/, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1839] | comment | Covalently bound structure in Manglik et al., Fig. 1b-Fig1c. Chemical formula % Sigma catalog entry. | xref | record_id "1839" | xref | delta_mono_mass "454.210387" | xref | delta_avge_mass "454.5155" | xref | delta_composition "H(30) C(25) N(2) O(6)" | xref | username_of_poster "shartson" | xref | group_of_poster "" | xref | date_time_posted "2016-08-26 19:59:17" | xref | date_time_modified "2017-01-31 10:02:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1840] === UNIMOD:1840 dHex(1)Hex(7)HexNAc(4) |
null .Term [UNIMOD:1840] [cols="2*"] |
| id | UNIMOD:1840 | name | dHex(1)Hex(7)HexNAc(4) | def | "Fucosylated biantennary + 2 alphaGal." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/23924801, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=7&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1840] | xref | record_id "1840" | xref | delta_mono_mass "2092.745164" | xref | delta_avge_mass "2093.8955" | xref | delta_composition "dHex Hex(7) HexNAc(4)" | xref | username_of_poster "suckau" | xref | group_of_poster "" | xref | date_time_posted "2016-09-05 15:52:53" | xref | date_time_modified "2016-09-09 16:57:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_misc_notes "observed in monoclonal antibodies" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1841] === UNIMOD:1841 Biotin:Thermo-21328 |
null .Term [UNIMOD:1841] [cols="2*"] |
| id | UNIMOD:1841 | name | Biotin:Thermo-21328 | def | "EZ-Link Sulfo-NHS-SS-Biotin." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011183_EZ_SulfoNHS_SS_Biotin_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1841] | synonym | "also Biotin:Thermo-21331" [] | xref | record_id "1841" | xref | delta_mono_mass "389.090154" | xref | delta_avge_mass "389.5564" | xref | delta_composition "H(23) C(15) N(3) O(3) S(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2016-11-11 10:34:53" | xref | date_time_modified "2016-11-11 10:36:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1843] === UNIMOD:1843 PhosphoCytidine |
null .Term [UNIMOD:1843] [cols="2*"] |
| id | UNIMOD:1843 | name | PhosphoCytidine | def | "Cytidine monophosphate." [URL:dx.doi.org/10.1038/nchembio0609-378, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1843] | comment | By analogy with AMP. | synonym | "CMP" [] | xref | record_id "1843" | xref | delta_mono_mass "305.041287" | xref | delta_avge_mass "305.1812" | xref | delta_composition "H(12) C(9) N(3) O(7) P" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-02-01 17:36:16" | xref | date_time_modified "2017-02-02 10:16:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Post-translational" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1845] === UNIMOD:1845 AzidoF |
null .Term [UNIMOD:1845] [cols="2*"] |
| id | UNIMOD:1845 | name | AzidoF | def | "Azidophenylalanine." [PMID:26597962, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1845] | xref | record_id "1845" | xref | delta_mono_mass "41.001397" | xref | delta_avge_mass "41.0122" | xref | delta_composition "H(-1) N(3)" | xref | username_of_poster "astridb" | xref | group_of_poster "" | xref | date_time_posted "2017-02-17 09:53:27" | xref | date_time_modified "2017-03-03 15:46:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "F" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1846] === UNIMOD:1846 Dimethylaminoethyl |
null .Term [UNIMOD:1846] [cols="2*"] |
| id | UNIMOD:1846 | name | Dimethylaminoethyl | def | "Cys alkylation by dimethylaminoethyl halide." [PMID:20373501, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1846] | xref | record_id "1846" | xref | delta_mono_mass "71.073499" | xref | delta_avge_mass "71.121" | xref | delta_composition "H(9) C(4) N" | xref | username_of_poster "Kramerh" | xref | group_of_poster "" | xref | date_time_posted "2017-02-17 16:10:59" | xref | date_time_modified "2017-03-03 15:50:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1848] === UNIMOD:1848 Gluratylation |
null .Term [UNIMOD:1848] [cols="2*"] |
| id | UNIMOD:1848 | name | Gluratylation | def | "Glutarylation." [PMID:24703693, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1848] | xref | record_id "1848" | xref | delta_mono_mass "114.031694" | xref | delta_avge_mass "114.0993" | xref | delta_composition "H(6) C(5) O(3)" | xref | username_of_poster "cfeller" | xref | group_of_poster "" | xref | date_time_posted "2017-03-30 11:15:26" | xref | date_time_modified "2017-04-05 12:31:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1849] === UNIMOD:1849 hydroxyisobutyryl |
null .Term [UNIMOD:1849] [cols="2*"] |
| id | UNIMOD:1849 | name | hydroxyisobutyryl | def | "2-hydroxyisobutyrylation." [PMID:24681537, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1849] | xref | record_id "1849" | xref | delta_mono_mass "86.036779" | xref | delta_avge_mass "86.0892" | xref | delta_composition "H(6) C(4) O(2)" | xref | username_of_poster "cfeller" | xref | group_of_poster "" | xref | date_time_posted "2017-03-30 11:16:14" | xref | date_time_modified "2019-09-10 09:07:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1868] === UNIMOD:1868 MeMePhosphorothioate |
null .Term [UNIMOD:1868] [cols="2*"] |
| id | UNIMOD:1868 | name | MeMePhosphorothioate | def | "S-Methyl Methyl phosphorothioate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1868] | xref | record_id "1868" | xref | delta_mono_mass "107.979873" | xref | delta_avge_mass "108.0993" | xref | delta_composition "H(5) C(2) O P S" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2017-04-11 18:32:43" | xref | date_time_modified "2017-06-02 16:01:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1870] === UNIMOD:1870 Cation:Fe[III] |
null .Term [UNIMOD:1870] [cols="2*"] |
| id | UNIMOD:1870 | name | Cation:Fe[III] | def | "Replacement of 3 protons by iron." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1870] | xref | record_id "1870" | xref | delta_mono_mass "52.911464" | xref | delta_avge_mass "52.8212" | xref | delta_composition "H(-3) Fe" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-06-15 12:58:58" | xref | date_time_modified "2017-06-15 12:58:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1871] === UNIMOD:1871 DTT |
null .Term [UNIMOD:1871] [cols="2*"] |
| id | UNIMOD:1871 | name | DTT | def | "DTT adduct of cysteine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1871] | xref | record_id "1871" | xref | delta_mono_mass "151.996571" | xref | delta_avge_mass "152.2351" | xref | delta_composition "H(8) C(4) O(2) S(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-06-15 14:09:46" | xref | date_time_modified "2017-06-15 14:12:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1872] === UNIMOD:1872 DYn-2 |
null .Term [UNIMOD:1872] [cols="2*"] |
| id | UNIMOD:1872 | name | DYn-2 | def | "Sulfenic Acid specific probe." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1872] | xref | record_id "1872" | xref | delta_mono_mass "161.09664" | xref | delta_avge_mass "161.2203" | xref | delta_composition "H(13) C(11) O" | xref | username_of_poster "SamanthaLapehn" | xref | group_of_poster "" | xref | date_time_posted "2017-07-06 17:23:58" | xref | date_time_modified "2017-08-05 02:16:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Other" | xref | spec_1_misc_notes "-SOH" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1873] === UNIMOD:1873 MesitylOxide |
null .Term [UNIMOD:1873] [cols="2*"] |
| id | UNIMOD:1873 | name | MesitylOxide | def | "Acetone chemical artifact." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1873] | xref | record_id "1873" | xref | delta_mono_mass "98.073165" | xref | delta_avge_mass "98.143" | xref | delta_composition "H(10) C(6) O" | xref | username_of_poster "mlefers" | xref | group_of_poster "" | xref | date_time_posted "2017-07-13 19:50:51" | xref | date_time_modified "2017-08-04 17:22:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1875] === UNIMOD:1875 methylol |
null .Term [UNIMOD:1875] [cols="2*"] |
| id | UNIMOD:1875 | name | methylol | def | "Formaldehyde induced modifications." [PMID:https://www.ncbi.nlm.nih.gov/pubmed/16704222, PMID:https://www.ncbi.nlm.nih.gov/pubmed/14638685, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1875] | xref | record_id "1875" | xref | delta_mono_mass "30.010565" | xref | delta_avge_mass "30.026" | xref | delta_composition "H(2) C O" | xref | username_of_poster "robertyen" | xref | group_of_poster "" | xref | date_time_posted "2017-07-14 18:43:02" | xref | date_time_modified "2017-08-04 17:27:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "W" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1877] === UNIMOD:1877 X259 |
null .Term [UNIMOD:1877] [cols="2*"] |
| id | UNIMOD:1877 | name | X259 | def | "Tris-quenched monolink of DSS/BS3 crosslinker." [PMID:8326953, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1877] | xref | record_id "1877" | xref | delta_mono_mass "259.141973" | xref | delta_avge_mass "259.2988" | xref | delta_composition "H(21) C(12) N O(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-17 14:29:30" | xref | date_time_modified "2017-08-17 15:09:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1878] === UNIMOD:1878 X176 |
null .Term [UNIMOD:1878] [cols="2*"] |
| id | UNIMOD:1878 | name | X176 | def | "Water-quenched monolink of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1878] | xref | record_id "1878" | xref | delta_mono_mass "176.01433" | xref | delta_avge_mass "176.1903" | xref | delta_composition "H(8) C(6) O(4) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-17 16:26:01" | xref | date_time_modified "2017-08-17 16:26:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1879] === UNIMOD:1879 X175 |
null .Term [UNIMOD:1879] [cols="2*"] |
| id | UNIMOD:1879 | name | X175 | def | "Ammonia-quenched monolink of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1879] | xref | record_id "1879" | xref | delta_mono_mass "175.030314" | xref | delta_avge_mass "175.2056" | xref | delta_composition "H(9) C(6) N O(3) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-17 16:27:45" | xref | date_time_modified "2017-08-17 16:27:45" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1880] === UNIMOD:1880 X279 |
null .Term [UNIMOD:1880] [cols="2*"] |
| id | UNIMOD:1880 | name | X279 | def | "Tris-quenched monolink of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1880] | xref | record_id "1880" | xref | delta_mono_mass "279.077658" | xref | delta_avge_mass "279.3101" | xref | delta_composition "H(17) C(10) N O(6) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-17 16:29:08" | xref | date_time_modified "2017-08-17 16:29:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1881] === UNIMOD:1881 X54 |
null .Term [UNIMOD:1881] [cols="2*"] |
| id | UNIMOD:1881 | name | X54 | def | "Alkene fragment of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1881] | xref | record_id "1881" | xref | delta_mono_mass "54.010565" | xref | delta_avge_mass "54.0474" | xref | delta_composition "H(2) C(3) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-17 16:31:03" | xref | date_time_modified "2017-08-17 16:31:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1882] === UNIMOD:1882 X86 |
null .Term [UNIMOD:1882] [cols="2*"] |
| id | UNIMOD:1882 | name | X86 | def | "Thiol fragment of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1882] | xref | record_id "1882" | xref | delta_mono_mass "85.982635" | xref | delta_avge_mass "86.1124" | xref | delta_composition "H(2) C(3) O S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-17 16:32:17" | xref | date_time_modified "2017-08-17 16:32:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1883] === UNIMOD:1883 X104 |
null .Term [UNIMOD:1883] [cols="2*"] |
| id | UNIMOD:1883 | name | X104 | def | "Sulfenic acid fragment of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1883] | xref | record_id "1883" | xref | delta_mono_mass "103.9932" | xref | delta_avge_mass "104.1277" | xref | delta_composition "H(4) C(3) O(2) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-17 16:33:16" | xref | date_time_modified "2017-08-17 16:33:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1885] === UNIMOD:1885 X111 |
null .Term [UNIMOD:1885] [cols="2*"] |
| id | UNIMOD:1885 | name | X111 | def | "BuUr fragment of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1885] | xref | record_id "1885" | xref | delta_mono_mass "111.032028" | xref | delta_avge_mass "111.0987" | xref | delta_composition "H(5) C(5) N O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-18 09:34:59" | xref | date_time_modified "2017-09-01 14:44:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1886] === UNIMOD:1886 X85 |
null .Term [UNIMOD:1886] [cols="2*"] |
| id | UNIMOD:1886 | name | X85 | def | "Bu fragment of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1886] | xref | record_id "1886" | xref | delta_mono_mass "85.052764" | xref | delta_avge_mass "85.1045" | xref | delta_composition "H(7) C(4) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-18 09:36:27" | xref | date_time_modified "2017-09-01 14:44:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1887] === UNIMOD:1887 X213 |
null .Term [UNIMOD:1887] [cols="2*"] |
| id | UNIMOD:1887 | name | X213 | def | "Ammonia quenched monolink of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1887] | xref | record_id "1887" | xref | delta_mono_mass "213.111341" | xref | delta_avge_mass "213.2337" | xref | delta_composition "H(15) C(9) N(3) O(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-18 09:38:52" | xref | date_time_modified "2017-09-01 14:46:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1888] === UNIMOD:1888 X214 |
null .Term [UNIMOD:1888] [cols="2*"] |
| id | UNIMOD:1888 | name | X214 | def | "Water quenched monolink of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1888] | xref | record_id "1888" | xref | delta_mono_mass "214.095357" | xref | delta_avge_mass "214.2185" | xref | delta_composition "H(14) C(9) N(2) O(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-18 09:43:05" | xref | date_time_modified "2017-09-01 14:46:10" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1889] === UNIMOD:1889 X317 |
null .Term [UNIMOD:1889] [cols="2*"] |
| id | UNIMOD:1889 | name | X317 | def | "Tris quenched monolink of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1889] | xref | record_id "1889" | xref | delta_mono_mass "317.158686" | xref | delta_avge_mass "317.3382" | xref | delta_composition "H(23) C(13) N(3) O(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-18 09:44:40" | xref | date_time_modified "2017-09-01 14:46:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1896] === UNIMOD:1896 X158 |
null .Term [UNIMOD:1896] [cols="2*"] |
| id | UNIMOD:1896 | name | X158 | def | "Intact DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1896] | xref | record_id "1896" | xref | delta_mono_mass "158.003765" | xref | delta_avge_mass "158.175" | xref | delta_composition "H(6) C(6) O(3) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-31 14:53:02" | xref | date_time_modified "2017-08-31 14:53:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1897] === UNIMOD:1897 X226 |
null .Term [UNIMOD:1897] [cols="2*"] |
| id | UNIMOD:1897 | name | X226 | def | "Intact EGS cross-linker." [PMID:36892, URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011281_EGS_SulfoEGS_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1897] | synonym | "Ethylene glycolbis(succinimidylsuccinate)" [] | xref | record_id "1897" | xref | delta_mono_mass "226.047738" | xref | delta_avge_mass "226.1828" | xref | delta_composition "H(10) C(10) O(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-31 14:54:57" | xref | date_time_modified "2017-08-31 14:54:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1898] === UNIMOD:1898 X138 |
null .Term [UNIMOD:1898] [cols="2*"] |
| id | UNIMOD:1898 | name | X138 | def | "Intact DSS/BS3 crosslinker." [PMID:8326953, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1898] | xref | record_id "1898" | xref | delta_mono_mass "138.06808" | xref | delta_avge_mass "138.1638" | xref | delta_composition "H(10) C(8) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-31 14:55:56" | xref | date_time_modified "2017-08-31 14:55:56" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1899] === UNIMOD:1899 X196 |
null .Term [UNIMOD:1899] [cols="2*"] |
| id | UNIMOD:1899 | name | X196 | def | "Intact BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1899] | xref | record_id "1899" | xref | delta_mono_mass "196.084792" | xref | delta_avge_mass "196.2032" | xref | delta_composition "H(12) C(9) N(2) O(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-31 14:57:02" | xref | date_time_modified "2017-09-01 14:45:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1900] === UNIMOD:1900 X172 |
null .Term [UNIMOD:1900] [cols="2*"] |
| id | UNIMOD:1900 | name | X172 | def | "Intact DTBP crosslinker." [PMID:770170, URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011314_ImidoesterCrsLnk_DMA_DMP_DMS_DTBP_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1900] | comment | Imidoester cross-linker. | synonym | "dimethyl 3,3'-dithiobispropionimidate" [] | xref | record_id "1900" | xref | delta_mono_mass "172.01289" | xref | delta_avge_mass "172.2711" | xref | delta_composition "H(8) C(6) N(2) S(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-31 14:59:08" | xref | date_time_modified "2017-08-31 14:59:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1901] === UNIMOD:1901 X114 |
null .Term [UNIMOD:1901] [cols="2*"] |
| id | UNIMOD:1901 | name | X114 | def | "Intact DST crosslinker." [PMID:212103, URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011282_DST_UG.pdf, PMID:3001048, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1901] | xref | record_id "1901" | xref | delta_mono_mass "113.995309" | xref | delta_avge_mass "114.0563" | xref | delta_composition "H(2) C(4) O(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-31 15:00:13" | xref | date_time_modified "2017-08-31 15:00:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1902] === UNIMOD:1902 X174 |
null .Term [UNIMOD:1902] [cols="2*"] |
| id | UNIMOD:1902 | name | X174 | def | "Intact DSP/DTSSP crosslinker." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011280_DTSSP_DSP_UG.pdf, PMID:1262347, PMID:8457554, PMID:322714, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1902] | synonym | "Also known as DSP" [] | xref | record_id "1902" | xref | delta_mono_mass "173.980921" | xref | delta_avge_mass "174.2406" | xref | delta_composition "H(6) C(6) O(2) S(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-31 15:01:08" | xref | date_time_modified "2017-08-31 15:01:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1903] === UNIMOD:1903 X219 |
null .Term [UNIMOD:1903] [cols="2*"] |
| id | UNIMOD:1903 | name | X219 | def | "Intact SMCC cross-link." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011295_SMCC_SulfoSMCC_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1903] | xref | record_id "1903" | xref | delta_mono_mass "219.089543" | xref | delta_avge_mass "219.2365" | xref | delta_composition "H(13) C(12) N O(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-08-31 15:02:14" | xref | date_time_modified "2017-09-05 15:00:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1905] === UNIMOD:1905 X96 |
null .Term [UNIMOD:1905] [cols="2*"] |
| id | UNIMOD:1905 | name | X96 | def | "Intact BS2-G crosslinker." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011542_BS3_d0d4_BS2G_d0d3_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1905] | xref | record_id "1905" | xref | delta_mono_mass "96.021129" | xref | delta_avge_mass "96.0841" | xref | delta_composition "H(4) C(5) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-09-05 16:22:19" | xref | date_time_modified "2017-09-05 16:22:37" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1906] === UNIMOD:1906 X113 |
null .Term [UNIMOD:1906] [cols="2*"] |
| id | UNIMOD:1906 | name | X113 | def | "Ammonium-quenched monolink of BS2-G crosslinker." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011542_BS3_d0d4_BS2G_d0d3_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1906] | xref | record_id "1906" | xref | delta_mono_mass "113.047679" | xref | delta_avge_mass "113.1146" | xref | delta_composition "H(7) C(5) N O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-09-05 16:26:19" | xref | date_time_modified "2017-09-05 16:26:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1907] === UNIMOD:1907 X114 |
null .Term [UNIMOD:1907] [cols="2*"] |
| id | UNIMOD:1907 | name | X114 | def | "Water-quenched monolink of BS2-G crosslinker." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011542_BS3_d0d4_BS2G_d0d3_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1907] | xref | record_id "1907" | xref | delta_mono_mass "114.031694" | xref | delta_avge_mass "114.0993" | xref | delta_composition "H(6) C(5) O(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-09-05 16:27:03" | xref | date_time_modified "2017-09-05 16:27:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1908] === UNIMOD:1908 X217 |
null .Term [UNIMOD:1908] [cols="2*"] |
| id | UNIMOD:1908 | name | X217 | def | "Tris-quenched monolink of BS2-G crosslinker." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011542_BS3_d0d4_BS2G_d0d3_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1908] | xref | record_id "1908" | xref | delta_mono_mass "217.095023" | xref | delta_avge_mass "217.2191" | xref | delta_composition "H(15) C(9) N O(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-09-05 16:28:28" | xref | date_time_modified "2017-09-05 16:28:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1910] === UNIMOD:1910 Cation:Al[III] |
null .Term [UNIMOD:1910] [cols="2*"] |
| id | UNIMOD:1910 | name | Cation:Al[III] | def | "Replacement of 3 protons by aluminium." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1910] | xref | record_id "1910" | xref | delta_mono_mass "23.958063" | xref | delta_avge_mass "23.9577" | xref | delta_composition "H(-3) Al" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-09-05 17:13:59" | xref | date_time_modified "2017-09-05 17:13:59" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1911] === UNIMOD:1911 X139 |
null .Term [UNIMOD:1911] [cols="2*"] |
| id | UNIMOD:1911 | name | X139 | def | "Ammonia quenched monolink of DMP crosslinker." [PMID:2144419, PMID:14696200, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1911] | synonym | "Dimethyl pimelimidate dead-end crosslink" [] | xref | record_id "1911" | xref | delta_mono_mass "139.110947" | xref | delta_avge_mass "139.1982" | xref | delta_composition "H(13) C(7) N(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-09-06 10:03:30" | xref | date_time_modified "2017-09-06 10:03:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1912] === UNIMOD:1912 X122 |
null .Term [UNIMOD:1912] [cols="2*"] |
| id | UNIMOD:1912 | name | X122 | def | "Intact DMP crosslinker." [PMID:2144419, PMID:14696200, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1912] | synonym | "Dimethyl pimelimidate" [] | xref | record_id "1912" | xref | delta_mono_mass "122.084398" | xref | delta_avge_mass "122.1677" | xref | delta_composition "H(10) C(7) N(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-09-06 10:04:39" | xref | date_time_modified "2017-09-06 10:04:39" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1913] === UNIMOD:1913 glyoxalAGE |
null .Term [UNIMOD:1913] [cols="2*"] |
| id | UNIMOD:1913 | name | glyoxalAGE | def | "Glyoxal-derived AGE." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1913] | xref | record_id "1913" | xref | delta_mono_mass "21.98435" | xref | delta_avge_mass "22.0055" | xref | delta_composition "H(-2) C(2)" | xref | username_of_poster "mlefers" | xref | group_of_poster "" | xref | date_time_posted "2017-10-05 13:54:48" | xref | date_time_modified "2017-11-08 17:25:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1914] === UNIMOD:1914 Met→AspSA |
null .Term [UNIMOD:1914] [cols="2*"] |
| id | UNIMOD:1914 | name | Met→AspSA | def | "Methionine oxidation to aspartic semialdehyde." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1914] | xref | record_id "1914" | xref | delta_mono_mass "-32.008456" | xref | delta_avge_mass "-32.1081" | xref | delta_composition "H(-4) C(-1) O S(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-10-06 15:35:18" | xref | date_time_modified "2017-10-06 15:37:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "M" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1915] === UNIMOD:1915 Decarboxylation |
null .Term [UNIMOD:1915] [cols="2*"] |
| id | UNIMOD:1915 | name | Decarboxylation | def | "Decarboxylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1915] | xref | record_id "1915" | xref | delta_mono_mass "-30.010565" | xref | delta_avge_mass "-30.026" | xref | delta_composition "H(-2) C(-1) O(-1)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-10-06 15:40:31" | xref | date_time_modified "2017-10-06 15:40:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1916] === UNIMOD:1916 Aspartylurea |
null .Term [UNIMOD:1916] [cols="2*"] |
| id | UNIMOD:1916 | name | Aspartylurea | def | "Aspartylurea." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1916] | xref | record_id "1916" | xref | delta_mono_mass "-10.031969" | xref | delta_avge_mass "-10.0412" | xref | delta_composition "H(-2) C(-1) N(-2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-10-06 15:43:52" | xref | date_time_modified "2017-10-06 15:43:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1917] === UNIMOD:1917 Formylasparagine |
null .Term [UNIMOD:1917] [cols="2*"] |
| id | UNIMOD:1917 | name | Formylasparagine | def | "In Bachi as Formylaspargine (typo?)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1917] | xref | record_id "1917" | xref | delta_mono_mass "4.97893" | xref | delta_avge_mass "4.9735" | xref | delta_composition "H(-1) C(-1) N(-1) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-10-06 16:01:29" | xref | date_time_modified "2017-11-02 17:23:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1918] === UNIMOD:1918 Carbonyl |
null .Term [UNIMOD:1918] [cols="2*"] |
| id | UNIMOD:1918 | name | Carbonyl | def | "Aldehyde and ketone modifications." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1918] | xref | record_id "1918" | xref | delta_mono_mass "13.979265" | xref | delta_avge_mass "13.9835" | xref | delta_composition "H(-2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-10-06 16:09:53" | xref | date_time_modified "2017-10-06 16:12:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "A" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "E" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "I" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "L" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "Q" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "R" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | xref | spec_7_group "7" | xref | spec_7_hidden "1" | xref | spec_7_site "S" | xref | spec_7_position "Anywhere" | xref | spec_7_classification "Chemical derivative" | xref | spec_8_group "8" | xref | spec_8_hidden "1" | xref | spec_8_site "V" | xref | spec_8_position "Anywhere" | xref | spec_8_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1920] === UNIMOD:1920 AFB1_Dialdehyde |
null .Term [UNIMOD:1920] [cols="2*"] |
| id | UNIMOD:1920 | name | AFB1_Dialdehyde | def | "Adduction of aflatoxin B1 Dialdehyde to lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1920] | xref | record_id "1920" | xref | delta_mono_mass "310.047738" | xref | delta_avge_mass "310.2577" | xref | delta_composition "H(10) C(17) O(6)" | xref | username_of_poster "shenmic" | xref | group_of_poster "" | xref | date_time_posted "2017-10-17 14:58:16" | xref | date_time_modified "2017-11-02 17:07:54" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1922] === UNIMOD:1922 Pro→HAVA |
null .Term [UNIMOD:1922] [cols="2*"] |
| id | UNIMOD:1922 | name | Pro→HAVA | def | "Proline oxidation to 5-hydroxy-2-aminovaleric acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1922] | xref | record_id "1922" | xref | delta_mono_mass "18.010565" | xref | delta_avge_mass "18.0153" | xref | delta_composition "H(2) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-03 09:13:16" | xref | date_time_modified "2017-11-03 09:13:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "P" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1923] === UNIMOD:1923 Delta:H(-4)O(2) |
null .Term [UNIMOD:1923] [cols="2*"] |
| id | UNIMOD:1923 | name | Delta:H(-4)O(2) | def | "Tryptophan oxidation to beta-unsaturated-2,4-bis-tryptophandione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1923] | xref | record_id "1923" | xref | delta_mono_mass "27.958529" | xref | delta_avge_mass "27.967" | xref | delta_composition "H(-4) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-03 09:17:12" | xref | date_time_modified "2017-11-08 17:00:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1924] === UNIMOD:1924 Delta:H(-4)O(3) |
null .Term [UNIMOD:1924] [cols="2*"] |
| id | UNIMOD:1924 | name | Delta:H(-4)O(3) | def | "Tryptophan oxidation to hydroxy-bis-tryptophandione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1924] | xref | record_id "1924" | xref | delta_mono_mass "43.953444" | xref | delta_avge_mass "43.9664" | xref | delta_composition "H(-4) O(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-08 16:11:21" | xref | date_time_modified "2017-11-08 17:01:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1925] === UNIMOD:1925 Delta:O(4) |
null .Term [UNIMOD:1925] [cols="2*"] |
| id | UNIMOD:1925 | name | Delta:O(4) | def | "Tryptophan oxidation to dihydroxy-N-formaylkynurenine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1925] | xref | record_id "1925" | xref | delta_mono_mass "63.979659" | xref | delta_avge_mass "63.9976" | xref | delta_composition "O(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-08 16:33:11" | xref | date_time_modified "2017-11-08 17:01:29" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "W" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1926] === UNIMOD:1926 Delta:H(3)C(3)O(2) |
null .Term [UNIMOD:1926] [cols="2*"] |
| id | UNIMOD:1926 | name | Delta:H(3)C(3)O(2) | def | "Methylglyoxal-derived carboxyethyllysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1926] | xref | record_id "1926" | xref | delta_mono_mass "71.013304" | xref | delta_avge_mass "71.0547" | xref | delta_composition "H(3) C(3) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-08 16:41:02" | xref | date_time_modified "2017-11-08 17:02:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1927] === UNIMOD:1927 Delta:H(4)C(5)O(1) |
null .Term [UNIMOD:1927] [cols="2*"] |
| id | UNIMOD:1927 | name | Delta:H(4)C(5)O(1) | def | "Methylglyoxal-derived argpyrimidine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1927] | xref | record_id "1927" | xref | delta_mono_mass "80.026215" | xref | delta_avge_mass "80.0847" | xref | delta_composition "H(4) C(5) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-08 16:43:41" | xref | date_time_modified "2018-06-26 10:38:31" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1928] === UNIMOD:1928 Delta:H(10)C(8)O(1) |
null .Term [UNIMOD:1928] [cols="2*"] |
| id | UNIMOD:1928 | name | Delta:H(10)C(8)O(1) | def | "Crotonaldehyde-derived dimethyl-FDP-lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1928] | xref | record_id "1928" | xref | delta_mono_mass "122.073165" | xref | delta_avge_mass "122.1644" | xref | delta_composition "H(10) C(8) O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-08 17:04:01" | xref | date_time_modified "2017-11-08 17:04:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1929] === UNIMOD:1929 Delta:H(6)C(7)O(4) |
null .Term [UNIMOD:1929] [cols="2*"] |
| id | UNIMOD:1929 | name | Delta:H(6)C(7)O(4) | def | "Methylglyoxal-derived tetrahydropyrimidine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1929] | xref | record_id "1929" | xref | delta_mono_mass "154.026609" | xref | delta_avge_mass "154.1201" | xref | delta_composition "H(6) C(7) O(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-08 17:12:02" | xref | date_time_modified "2017-11-08 17:12:02" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "R" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1930] === UNIMOD:1930 Pent(2) |
null .Term [UNIMOD:1930] [cols="2*"] |
| id | UNIMOD:1930 | name | Pent(2) | def | "Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1930] | xref | record_id "1930" | xref | delta_mono_mass "264.084518" | xref | delta_avge_mass "264.2292" | xref | delta_composition "Pent(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 12:05:50" | xref | date_time_modified "2017-11-23 13:01:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_265_mono_mass "264.084518" | xref | spec_1_neutral_loss_265_avge_mass "264.2292" | xref | spec_1_neutral_loss_265_flag "false" | xref | spec_1_neutral_loss_265_composition "Pent(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_265_mono_mass "264.084518" | xref | spec_1_neutral_loss_265_avge_mass "264.2292" | xref | spec_1_neutral_loss_265_flag "false" | xref | spec_1_neutral_loss_265_composition "Pent(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1931] === UNIMOD:1931 Pent(1)HexNAc(1) |
null .Term [UNIMOD:1931] [cols="2*"] |
| id | UNIMOD:1931 | name | Pent(1)HexNAc(1) | def | "Pent HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1931] | xref | record_id "1931" | xref | delta_mono_mass "335.121631" | xref | delta_avge_mass "335.3071" | xref | delta_composition "Pent HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 13:00:37" | xref | date_time_modified "2017-11-23 13:05:51" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_336_mono_mass "335.121631" | xref | spec_1_neutral_loss_336_avge_mass "335.3071" | xref | spec_1_neutral_loss_336_flag "false" | xref | spec_1_neutral_loss_336_composition "Pent HexNAc" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_336_mono_mass "335.121631" | xref | spec_1_neutral_loss_336_avge_mass "335.3071" | xref | spec_1_neutral_loss_336_flag "false" | xref | spec_1_neutral_loss_336_composition "Pent HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1932] === UNIMOD:1932 Hex(2)Sulf(1) |
null .Term [UNIMOD:1932] [cols="2*"] |
| id | UNIMOD:1932 | name | Hex(2)Sulf(1) | def | "Hex(2) O(3) S." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1932] | xref | record_id "1932" | xref | delta_mono_mass "404.062462" | xref | delta_avge_mass "404.3444" | xref | delta_composition "O(3) S Hex(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 15:39:42" | xref | date_time_modified "2017-11-23 15:40:36" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_405_mono_mass "404.062462" | xref | spec_1_neutral_loss_405_avge_mass "404.3444" | xref | spec_1_neutral_loss_405_flag "false" | xref | spec_1_neutral_loss_405_composition "O(3) S Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_405_mono_mass "404.062462" | xref | spec_1_neutral_loss_405_avge_mass "404.3444" | xref | spec_1_neutral_loss_405_flag "false" | xref | spec_1_neutral_loss_405_composition "O(3) S Hex(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1933] === UNIMOD:1933 Hex(1)Pent(2)Me(1) |
null .Term [UNIMOD:1933] [cols="2*"] |
| id | UNIMOD:1933 | name | Hex(1)Pent(2)Me(1) | def | "Hex:1 Pent:2 Me:1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&pent=2&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1933] | xref | record_id "1933" | xref | delta_mono_mass "440.152991" | xref | delta_avge_mass "440.3964" | xref | delta_composition "Me Pent(2) Hex" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 15:47:22" | xref | date_time_modified "2017-11-23 15:49:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_441_mono_mass "440.152991" | xref | spec_1_neutral_loss_441_avge_mass "440.3964" | xref | spec_1_neutral_loss_441_flag "false" | xref | spec_1_neutral_loss_441_composition "Me Pent(2) Hex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_441_mono_mass "440.152991" | xref | spec_1_neutral_loss_441_avge_mass "440.3964" | xref | spec_1_neutral_loss_441_flag "false" | xref | spec_1_neutral_loss_441_composition "Me Pent(2) Hex" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1934] === UNIMOD:1934 HexNAc(2)Sulf(1) |
null .Term [UNIMOD:1934] [cols="2*"] |
| id | UNIMOD:1934 | name | HexNAc(2)Sulf(1) | def | "HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1934] | xref | record_id "1934" | xref | delta_mono_mass "486.11556" | xref | delta_avge_mass "486.4482" | xref | delta_composition "O(3) S HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 16:35:09" | xref | date_time_modified "2017-11-23 16:35:09" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_487_mono_mass "486.11556" | xref | spec_1_neutral_loss_487_avge_mass "486.4482" | xref | spec_1_neutral_loss_487_flag "false" | xref | spec_1_neutral_loss_487_composition "O(3) S HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_487_mono_mass "486.11556" | xref | spec_1_neutral_loss_487_avge_mass "486.4482" | xref | spec_1_neutral_loss_487_flag "false" | xref | spec_1_neutral_loss_487_composition "O(3) S HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1935] === UNIMOD:1935 Hex(1)Pent(3)Me(1) |
null .Term [UNIMOD:1935] [cols="2*"] |
| id | UNIMOD:1935 | name | Hex(1)Pent(3)Me(1) | def | "Hex Pent(3) Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&pent=3&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1935] | xref | record_id "1935" | xref | delta_mono_mass "572.19525" | xref | delta_avge_mass "572.511" | xref | delta_composition "Me Pent(3) Hex" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 16:40:05" | xref | date_time_modified "2017-11-23 16:40:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_573_mono_mass "572.19525" | xref | spec_1_neutral_loss_573_avge_mass "572.511" | xref | spec_1_neutral_loss_573_flag "false" | xref | spec_1_neutral_loss_573_composition "Me Pent(3) Hex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_573_mono_mass "572.19525" | xref | spec_1_neutral_loss_573_avge_mass "572.511" | xref | spec_1_neutral_loss_573_flag "false" | xref | spec_1_neutral_loss_573_composition "Me Pent(3) Hex" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1936] === UNIMOD:1936 Hex(2)Pent(2) |
null .Term [UNIMOD:1936] [cols="2*"] |
| id | UNIMOD:1936 | name | Hex(2)Pent(2) | def | "Hex(2) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=2&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1936] | xref | record_id "1936" | xref | delta_mono_mass "588.190165" | xref | delta_avge_mass "588.5104" | xref | delta_composition "Pent(2) Hex(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 17:22:55" | xref | date_time_modified "2017-11-23 17:22:55" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_589_mono_mass "588.190165" | xref | spec_1_neutral_loss_589_avge_mass "588.5104" | xref | spec_1_neutral_loss_589_flag "false" | xref | spec_1_neutral_loss_589_composition "Pent(2) Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_589_mono_mass "588.190165" | xref | spec_1_neutral_loss_589_avge_mass "588.5104" | xref | spec_1_neutral_loss_589_flag "false" | xref | spec_1_neutral_loss_589_composition "Pent(2) Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1937] === UNIMOD:1937 Hex(2)Pent(2)Me(1) |
null .Term [UNIMOD:1937] [cols="2*"] |
| id | UNIMOD:1937 | name | Hex(2)Pent(2)Me(1) | def | "Hex(2) Pent(2) Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&pent=2&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1937] | xref | record_id "1937" | xref | delta_mono_mass "602.205815" | xref | delta_avge_mass "602.537" | xref | delta_composition "Me Pent(2) Hex(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 17:24:00" | xref | date_time_modified "2017-11-23 17:24:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_603_mono_mass "602.205815" | xref | spec_1_neutral_loss_603_avge_mass "602.537" | xref | spec_1_neutral_loss_603_flag "false" | xref | spec_1_neutral_loss_603_composition "Me Pent(2) Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_603_mono_mass "602.205815" | xref | spec_1_neutral_loss_603_avge_mass "602.537" | xref | spec_1_neutral_loss_603_flag "false" | xref | spec_1_neutral_loss_603_composition "Me Pent(2) Hex(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1938] === UNIMOD:1938 Hex(4)HexA(1) |
null .Term [UNIMOD:1938] [cols="2*"] |
| id | UNIMOD:1938 | name | Hex(4)HexA(1) | def | "Hex(4) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1938] | xref | record_id "1938" | xref | delta_mono_mass "824.243382" | xref | delta_avge_mass "824.6865" | xref | delta_composition "Hex(4) HexA" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 17:49:25" | xref | date_time_modified "2017-11-23 17:49:25" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_825_mono_mass "824.243382" | xref | spec_1_neutral_loss_825_avge_mass "824.6865" | xref | spec_1_neutral_loss_825_flag "false" | xref | spec_1_neutral_loss_825_composition "Hex(4) HexA" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_825_mono_mass "824.243382" | xref | spec_1_neutral_loss_825_avge_mass "824.6865" | xref | spec_1_neutral_loss_825_flag "false" | xref | spec_1_neutral_loss_825_composition "Hex(4) HexA" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1939] === UNIMOD:1939 Hex(2)HexNAc(1)Pent(1)HexA(1) |
null .Term [UNIMOD:1939] [cols="2*"] |
| id | UNIMOD:1939 | name | Hex(2)HexNAc(1)Pent(1)HexA(1) | def | "Hex(2) HexNAc Pent HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1939] | xref | record_id "1939" | xref | delta_mono_mass "835.259366" | xref | delta_avge_mass "835.7125" | xref | delta_composition "Pent Hex(2) HexA HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-23 17:51:41" | xref | date_time_modified "2017-11-23 17:51:41" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_836_mono_mass "835.259366" | xref | spec_1_neutral_loss_836_avge_mass "835.7125" | xref | spec_1_neutral_loss_836_flag "false" | xref | spec_1_neutral_loss_836_composition "Pent Hex(2) HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_836_mono_mass "835.259366" | xref | spec_1_neutral_loss_836_avge_mass "835.7125" | xref | spec_1_neutral_loss_836_flag "false" | xref | spec_1_neutral_loss_836_composition "Pent Hex(2) HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1940] === UNIMOD:1940 Hex(3)HexNAc(1)HexA(1) |
null .Term [UNIMOD:1940] [cols="2*"] |
| id | UNIMOD:1940 | name | Hex(3)HexNAc(1)HexA(1) | def | "Hex(3) HexNAc HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1940] | xref | record_id "1940" | xref | delta_mono_mass "865.269931" | xref | delta_avge_mass "865.7384" | xref | delta_composition "Hex(3) HexA HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 10:41:50" | xref | date_time_modified "2017-11-24 10:41:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_866_mono_mass "865.269931" | xref | spec_1_neutral_loss_866_avge_mass "865.7384" | xref | spec_1_neutral_loss_866_flag "false" | xref | spec_1_neutral_loss_866_composition "Hex(3) HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_866_mono_mass "865.269931" | xref | spec_1_neutral_loss_866_avge_mass "865.7384" | xref | spec_1_neutral_loss_866_flag "false" | xref | spec_1_neutral_loss_866_composition "Hex(3) HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1941] === UNIMOD:1941 Hex(1)HexNAc(2)dHex(2)Sulf(1) |
null .Term [UNIMOD:1941] [cols="2*"] |
| id | UNIMOD:1941 | name | Hex(1)HexNAc(2)dHex(2)Sulf(1) | def | "Hex HexNAc(2) dHex(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1941] | xref | record_id "1941" | xref | delta_mono_mass "940.284201" | xref | delta_avge_mass "940.8712" | xref | delta_composition "O(3) S dHex(2) Hex HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 10:45:35" | xref | date_time_modified "2017-11-24 10:45:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_941_mono_mass "940.284201" | xref | spec_1_neutral_loss_941_avge_mass "940.8712" | xref | spec_1_neutral_loss_941_flag "false" | xref | spec_1_neutral_loss_941_composition "O(3) S dHex(2) Hex HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_941_mono_mass "940.284201" | xref | spec_1_neutral_loss_941_avge_mass "940.8712" | xref | spec_1_neutral_loss_941_flag "false" | xref | spec_1_neutral_loss_941_composition "O(3) S dHex(2) Hex HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1942] === UNIMOD:1942 HexA(2)HexNAc(3) |
null .Term [UNIMOD:1942] [cols="2*"] |
| id | UNIMOD:1942 | name | HexA(2)HexNAc(3) | def | "HexA(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexa=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1942] | xref | record_id "1942" | xref | delta_mono_mass "961.302294" | xref | delta_avge_mass "961.8258" | xref | delta_composition "HexA(2) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 10:48:18" | xref | date_time_modified "2017-11-24 10:48:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_962_mono_mass "961.302294" | xref | spec_1_neutral_loss_962_avge_mass "961.8258" | xref | spec_1_neutral_loss_962_flag "false" | xref | spec_1_neutral_loss_962_composition "HexA(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_962_mono_mass "961.302294" | xref | spec_1_neutral_loss_962_avge_mass "961.8258" | xref | spec_1_neutral_loss_962_flag "false" | xref | spec_1_neutral_loss_962_composition "HexA(2) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1943] === UNIMOD:1943 dHex(1)Hex(4)HexA(1) |
null .Term [UNIMOD:1943] [cols="2*"] |
| id | UNIMOD:1943 | name | dHex(1)Hex(4)HexA(1) | def | "DHex Hex(4) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1943] | xref | record_id "1943" | xref | delta_mono_mass "970.301291" | xref | delta_avge_mass "970.8277" | xref | delta_composition "dHex Hex(4) HexA" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 10:51:51" | xref | date_time_modified "2017-11-24 10:52:38" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_971_mono_mass "970.301291" | xref | spec_1_neutral_loss_971_avge_mass "970.8277" | xref | spec_1_neutral_loss_971_flag "false" | xref | spec_1_neutral_loss_971_composition "dHex Hex(4) HexA" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_971_mono_mass "970.301291" | xref | spec_1_neutral_loss_971_avge_mass "970.8277" | xref | spec_1_neutral_loss_971_flag "false" | xref | spec_1_neutral_loss_971_composition "dHex Hex(4) HexA" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1944] === UNIMOD:1944 Hex(5)HexA(1) |
null .Term [UNIMOD:1944] [cols="2*"] |
| id | UNIMOD:1944 | name | Hex(5)HexA(1) | def | "Hex(5) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1944] | xref | record_id "1944" | xref | delta_mono_mass "986.296206" | xref | delta_avge_mass "986.8271" | xref | delta_composition "Hex(5) HexA" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 10:54:21" | xref | date_time_modified "2017-11-24 10:54:21" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_987_mono_mass "986.296206" | xref | spec_1_neutral_loss_987_avge_mass "986.8271" | xref | spec_1_neutral_loss_987_flag "false" | xref | spec_1_neutral_loss_987_composition "Hex(5) HexA" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_987_mono_mass "986.296206" | xref | spec_1_neutral_loss_987_avge_mass "986.8271" | xref | spec_1_neutral_loss_987_flag "false" | xref | spec_1_neutral_loss_987_composition "Hex(5) HexA" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1945] === UNIMOD:1945 Hex(4)HexA(1)HexNAc(1) |
null .Term [UNIMOD:1945] [cols="2*"] |
| id | UNIMOD:1945 | name | Hex(4)HexA(1)HexNAc(1) | def | "Hex(4) HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1945] | xref | record_id "1945" | xref | delta_mono_mass "1027.322755" | xref | delta_avge_mass "1027.879" | xref | delta_composition "Hex(4) HexA HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 11:02:26" | xref | date_time_modified "2017-11-24 11:03:00" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1028_mono_mass "1027.322755" | xref | spec_1_neutral_loss_1028_avge_mass "1027.879" | xref | spec_1_neutral_loss_1028_flag "false" | xref | spec_1_neutral_loss_1028_composition "Hex(4) HexA HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1028_mono_mass "1027.322755" | xref | spec_1_neutral_loss_1028_avge_mass "1027.879" | xref | spec_1_neutral_loss_1028_flag "false" | xref | spec_1_neutral_loss_1028_composition "Hex(4) HexA HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1946] === UNIMOD:1946 dHex(3)Hex(3)HexNAc(1) |
null .Term [UNIMOD:1946] [cols="2*"] |
| id | UNIMOD:1946 | name | dHex(3)Hex(3)HexNAc(1) | def | "DHex(3) Hex(3) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1946] | xref | record_id "1946" | xref | delta_mono_mass "1127.41157" | xref | delta_avge_mass "1128.0379" | xref | delta_composition "dHex(3) Hex(3) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 11:05:19" | xref | date_time_modified "2017-11-24 11:05:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1128_mono_mass "1127.41157" | xref | spec_1_neutral_loss_1128_avge_mass "1128.0379" | xref | spec_1_neutral_loss_1128_flag "false" | xref | spec_1_neutral_loss_1128_composition "dHex(3) Hex(3) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1128_mono_mass "1127.41157" | xref | spec_1_neutral_loss_1128_avge_mass "1128.0379" | xref | spec_1_neutral_loss_1128_flag "false" | xref | spec_1_neutral_loss_1128_composition "dHex(3) Hex(3) HexNAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1947] === UNIMOD:1947 Hex(6)HexNAc(1) |
null .Term [UNIMOD:1947] [cols="2*"] |
| id | UNIMOD:1947 | name | Hex(6)HexNAc(1) | def | "Hex(6) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1947] | xref | record_id "1947" | xref | delta_mono_mass "1175.396314" | xref | delta_avge_mass "1176.0361" | xref | delta_composition "Hex(6) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 11:50:56" | xref | date_time_modified "2018-03-28 14:15:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1176_mono_mass "1175.396314" | xref | spec_1_neutral_loss_1176_avge_mass "1176.0361" | xref | spec_1_neutral_loss_1176_flag "false" | xref | spec_1_neutral_loss_1176_composition "Hex(6) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1948] === UNIMOD:1948 Hex(1)HexNAc(4)dHex(1)Sulf(1) |
null .Term [UNIMOD:1948] [cols="2*"] |
| id | UNIMOD:1948 | name | Hex(1)HexNAc(4)dHex(1)Sulf(1) | def | "Sulf dHex Hex HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1948] | xref | record_id "1948" | xref | delta_mono_mass "1200.385037" | xref | delta_avge_mass "1201.1151" | xref | delta_composition "Sulf dHex Hex HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 11:56:31" | xref | date_time_modified "2017-11-24 11:57:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1201_mono_mass "1200.385037" | xref | spec_1_neutral_loss_1201_avge_mass "1201.1151" | xref | spec_1_neutral_loss_1201_flag "false" | xref | spec_1_neutral_loss_1201_composition "Sulf dHex Hex HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1201_mono_mass "1200.385037" | xref | spec_1_neutral_loss_1201_avge_mass "1201.1151" | xref | spec_1_neutral_loss_1201_flag "false" | xref | spec_1_neutral_loss_1201_composition "Sulf dHex Hex HexNAc(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1949] === UNIMOD:1949 dHex(1)Hex(2)HexNAc(1)NeuAc(2) |
null .Term [UNIMOD:1949] [cols="2*"] |
| id | UNIMOD:1949 | name | dHex(1)Hex(2)HexNAc(1)NeuAc(2) | def | "DHex Hex(2) HexNAc NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=1&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1949] | xref | record_id "1949" | xref | delta_mono_mass "1255.433762" | xref | delta_avge_mass "1256.1241" | xref | delta_composition "dHex Hex(2) HexNAc NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 11:58:40" | xref | date_time_modified "2017-11-24 13:36:28" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1256_mono_mass "1255.433762" | xref | spec_1_neutral_loss_1256_avge_mass "1256.1241" | xref | spec_1_neutral_loss_1256_flag "false" | xref | spec_1_neutral_loss_1256_composition "dHex Hex(2) HexNAc NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1256_mono_mass "1255.433762" | xref | spec_1_neutral_loss_1256_avge_mass "1256.1241" | xref | spec_1_neutral_loss_1256_flag "false" | xref | spec_1_neutral_loss_1256_composition "dHex Hex(2) HexNAc NeuAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1950] === UNIMOD:1950 dHex(3)Hex(3)HexNAc(2) |
null .Term [UNIMOD:1950] [cols="2*"] |
| id | UNIMOD:1950 | name | dHex(3)Hex(3)HexNAc(2) | def | "DHex(3) Hex(3) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1950] | xref | record_id "1950" | xref | delta_mono_mass "1330.490942" | xref | delta_avge_mass "1331.2304" | xref | delta_composition "dHex(3) Hex(3) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 12:05:34" | xref | date_time_modified "2017-11-24 12:06:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1331_mono_mass "1330.490942" | xref | spec_1_neutral_loss_1331_avge_mass "1331.2304" | xref | spec_1_neutral_loss_1331_flag "false" | xref | spec_1_neutral_loss_1331_composition "dHex(3) Hex(3) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1331_mono_mass "1330.490942" | xref | spec_1_neutral_loss_1331_avge_mass "1331.2304" | xref | spec_1_neutral_loss_1331_flag "false" | xref | spec_1_neutral_loss_1331_composition "dHex(3) Hex(3) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1951] === UNIMOD:1951 dHex(2)Hex(1)HexNAc(4)Sulf(1) |
null .Term [UNIMOD:1951] [cols="2*"] |
| id | UNIMOD:1951 | name | dHex(2)Hex(1)HexNAc(4)Sulf(1) | def | "DHex(2) Hex HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=1&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1951] | xref | record_id "1951" | xref | delta_mono_mass "1346.442946" | xref | delta_avge_mass "1347.2563" | xref | delta_composition "Sulf dHex(2) Hex HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 12:07:49" | xref | date_time_modified "2017-11-24 12:08:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1347_mono_mass "1346.442946" | xref | spec_1_neutral_loss_1347_avge_mass "1347.2563" | xref | spec_1_neutral_loss_1347_flag "false" | xref | spec_1_neutral_loss_1347_composition "Sulf dHex(2) Hex HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1347_mono_mass "1346.442946" | xref | spec_1_neutral_loss_1347_avge_mass "1347.2563" | xref | spec_1_neutral_loss_1347_flag "false" | xref | spec_1_neutral_loss_1347_composition "Sulf dHex(2) Hex HexNAc(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1952] === UNIMOD:1952 dHex(1)Hex(2)HexNAc(4)Sulf(2) |
null .Term [UNIMOD:1952] [cols="2*"] |
| id | UNIMOD:1952 | name | dHex(1)Hex(2)HexNAc(4)Sulf(2) | def | "DHex Hex(2) HexNAc(4) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=1&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1952] | xref | record_id "1952" | xref | delta_mono_mass "1442.394675" | xref | delta_avge_mass "1443.3189" | xref | delta_composition "Sulf(2) dHex Hex(2) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 12:56:06" | xref | date_time_modified "2017-11-24 12:57:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1443_mono_mass "1442.394675" | xref | spec_1_neutral_loss_1443_avge_mass "1443.3189" | xref | spec_1_neutral_loss_1443_flag "false" | xref | spec_1_neutral_loss_1443_composition "Sulf(2) dHex Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1443_mono_mass "1442.394675" | xref | spec_1_neutral_loss_1443_avge_mass "1443.3189" | xref | spec_1_neutral_loss_1443_flag "false" | xref | spec_1_neutral_loss_1443_composition "Sulf(2) dHex Hex(2) HexNAc(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1953] === UNIMOD:1953 Hex(9) |
null .Term [UNIMOD:1953] [cols="2*"] |
| id | UNIMOD:1953 | name | Hex(9) | def | "Hex(9)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=9&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1953] | xref | record_id "1953" | xref | delta_mono_mass "1458.475412" | xref | delta_avge_mass "1459.2654" | xref | delta_composition "Hex(9)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 12:58:01" | xref | date_time_modified "2017-11-24 12:58:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1459_mono_mass "1458.475412" | xref | spec_1_neutral_loss_1459_avge_mass "1459.2654" | xref | spec_1_neutral_loss_1459_flag "false" | xref | spec_1_neutral_loss_1459_composition "Hex(9)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1954] === UNIMOD:1954 dHex(2)Hex(3)HexNAc(3)Sulf(1) |
null .Term [UNIMOD:1954] [cols="2*"] |
| id | UNIMOD:1954 | name | dHex(2)Hex(3)HexNAc(3)Sulf(1) | def | "Sulf dHex(2) Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1954] | xref | record_id "1954" | xref | delta_mono_mass "1467.469221" | xref | delta_avge_mass "1468.345" | xref | delta_composition "Sulf dHex(2) Hex(3) HexNAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 12:59:19" | xref | date_time_modified "2017-11-24 13:00:08" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1468_mono_mass "1467.469221" | xref | spec_1_neutral_loss_1468_avge_mass "1468.345" | xref | spec_1_neutral_loss_1468_flag "false" | xref | spec_1_neutral_loss_1468_composition "Sulf dHex(2) Hex(3) HexNAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1468_mono_mass "1467.469221" | xref | spec_1_neutral_loss_1468_avge_mass "1468.345" | xref | spec_1_neutral_loss_1468_flag "false" | xref | spec_1_neutral_loss_1468_composition "Sulf dHex(2) Hex(3) HexNAc(3)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1955] === UNIMOD:1955 dHex(2)Hex(5)HexNAc(2)Me(1) |
null .Term [UNIMOD:1955] [cols="2*"] |
| id | UNIMOD:1955 | name | dHex(2)Hex(5)HexNAc(2)Me(1) | def | "Me dHex(2) Hex(5) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&dhex=2&hex=5&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1955] | xref | record_id "1955" | xref | delta_mono_mass "1522.554331" | xref | delta_avge_mass "1523.397" | xref | delta_composition "Me dHex(2) Hex(5) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:02:33" | xref | date_time_modified "2017-11-24 13:03:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1523_mono_mass "1522.554331" | xref | spec_1_neutral_loss_1523_avge_mass "1523.397" | xref | spec_1_neutral_loss_1523_flag "false" | xref | spec_1_neutral_loss_1523_composition "Me dHex(2) Hex(5) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1523_mono_mass "1522.554331" | xref | spec_1_neutral_loss_1523_avge_mass "1523.397" | xref | spec_1_neutral_loss_1523_flag "false" | xref | spec_1_neutral_loss_1523_composition "Me dHex(2) Hex(5) HexNAc(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1956] === UNIMOD:1956 dHex(2)Hex(2)HexNAc(4)Sulf(2) |
null .Term [UNIMOD:1956] [cols="2*"] |
| id | UNIMOD:1956 | name | dHex(2)Hex(2)HexNAc(4)Sulf(2) | def | "Sulf(2) dHex(2) Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=2&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1956] | xref | record_id "1956" | xref | delta_mono_mass "1588.452584" | xref | delta_avge_mass "1589.4601" | xref | delta_composition "Sulf(2) dHex(2) Hex(2) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:04:31" | xref | date_time_modified "2017-11-24 13:05:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1589_mono_mass "1588.452584" | xref | spec_1_neutral_loss_1589_avge_mass "1589.4601" | xref | spec_1_neutral_loss_1589_flag "false" | xref | spec_1_neutral_loss_1589_composition "Sulf(2) dHex(2) Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1589_mono_mass "1588.452584" | xref | spec_1_neutral_loss_1589_avge_mass "1589.4601" | xref | spec_1_neutral_loss_1589_flag "false" | xref | spec_1_neutral_loss_1589_composition "Sulf(2) dHex(2) Hex(2) HexNAc(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1957] === UNIMOD:1957 Hex(9)HexNAc(1) |
null .Term [UNIMOD:1957] [cols="2*"] |
| id | UNIMOD:1957 | name | Hex(9)HexNAc(1) | def | "Hex(9) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=9&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1957] | xref | record_id "1957" | xref | delta_mono_mass "1661.554784" | xref | delta_avge_mass "1662.4579" | xref | delta_composition "Hex(9) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:09:44" | xref | date_time_modified "2017-11-24 13:09:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1662_mono_mass "1661.554784" | xref | spec_1_neutral_loss_1662_avge_mass "1662.4579" | xref | spec_1_neutral_loss_1662_flag "false" | xref | spec_1_neutral_loss_1662_composition "Hex(9) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1958] === UNIMOD:1958 dHex(3)Hex(2)HexNAc(4)Sulf(2) |
null .Term [UNIMOD:1958] [cols="2*"] |
| id | UNIMOD:1958 | name | dHex(3)Hex(2)HexNAc(4)Sulf(2) | def | "DHex(3) Hex(2) HexNAc(4) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=3&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1958] | xref | record_id "1958" | xref | delta_mono_mass "1734.510493" | xref | delta_avge_mass "1735.6013" | xref | delta_composition "Sulf(2) dHex(3) Hex(2) HexNAc(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:31:20" | xref | date_time_modified "2017-11-24 13:31:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1735_mono_mass "1734.510493" | xref | spec_1_neutral_loss_1735_avge_mass "1735.6013" | xref | spec_1_neutral_loss_1735_flag "false" | xref | spec_1_neutral_loss_1735_composition "Sulf(2) dHex(3) Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1735_mono_mass "1734.510493" | xref | spec_1_neutral_loss_1735_avge_mass "1735.6013" | xref | spec_1_neutral_loss_1735_flag "false" | xref | spec_1_neutral_loss_1735_composition "Sulf(2) dHex(3) Hex(2) HexNAc(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1959] === UNIMOD:1959 Hex(4)HexNAc(4)NeuGc(1) |
null .Term [UNIMOD:1959] [cols="2*"] |
| id | UNIMOD:1959 | name | Hex(4)HexNAc(4)NeuGc(1) | def | "Hex(4) HexNAc(4) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1959] | xref | record_id "1959" | xref | delta_mono_mass "1767.619116" | xref | delta_avge_mass "1768.5865" | xref | delta_composition "Hex(4) HexNAc(4) NeuGc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:33:34" | xref | date_time_modified "2017-11-24 13:33:34" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1768_mono_mass "1767.619116" | xref | spec_1_neutral_loss_1768_avge_mass "1768.5865" | xref | spec_1_neutral_loss_1768_flag "false" | xref | spec_1_neutral_loss_1768_composition "Hex(4) HexNAc(4) NeuGc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "S" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_1768_mono_mass "1767.619116" | xref | spec_2_neutral_loss_1768_avge_mass "1768.5865" | xref | spec_2_neutral_loss_1768_flag "false" | xref | spec_2_neutral_loss_1768_composition "Hex(4) HexNAc(4) NeuGc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "T" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "O-linked glycosylation" | xref | spec_2_neutral_loss_1768_mono_mass "1767.619116" | xref | spec_2_neutral_loss_1768_avge_mass "1768.5865" | xref | spec_2_neutral_loss_1768_flag "false" | xref | spec_2_neutral_loss_1768_composition "Hex(4) HexNAc(4) NeuGc" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1960] === UNIMOD:1960 dHex(4)Hex(3)HexNAc(2)NeuAc(1) |
null .Term [UNIMOD:1960] [cols="2*"] |
| id | UNIMOD:1960 | name | dHex(4)Hex(3)HexNAc(2)NeuAc(1) | def | "DHex(4) Hex(3) HexNAc(2) NeuAc(1)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=3&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1960] | xref | record_id "1960" | xref | delta_mono_mass "1767.644268" | xref | delta_avge_mass "1768.6262" | xref | delta_composition "dHex(4) Hex(3) HexNAc(2) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:39:20" | xref | date_time_modified "2017-11-24 13:40:01" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1768_mono_mass "1767.644268" | xref | spec_1_neutral_loss_1768_avge_mass "1768.6262" | xref | spec_1_neutral_loss_1768_flag "false" | xref | spec_1_neutral_loss_1768_composition "dHex(4) Hex(3) HexNAc(2) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_neutral_loss_1768_mono_mass "1767.644268" | xref | spec_1_neutral_loss_1768_avge_mass "1768.6262" | xref | spec_1_neutral_loss_1768_flag "false" | xref | spec_1_neutral_loss_1768_composition "dHex(4) Hex(3) HexNAc(2) NeuAc" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1961] === UNIMOD:1961 Hex(3)HexNAc(5)NeuAc(1) |
null .Term [UNIMOD:1961] [cols="2*"] |
| id | UNIMOD:1961 | name | Hex(3)HexNAc(5)NeuAc(1) | def | "Hex(3) HexNAc(5) NeuAc(1)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=5&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1961] | xref | record_id "1961" | xref | delta_mono_mass "1792.65075" | xref | delta_avge_mass "1793.639" | xref | delta_composition "Hex(3) HexNAc(5) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:41:14" | xref | date_time_modified "2017-11-24 13:41:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1793_mono_mass "1792.65075" | xref | spec_1_neutral_loss_1793_avge_mass "1793.639" | xref | spec_1_neutral_loss_1793_flag "false" | xref | spec_1_neutral_loss_1793_composition "Hex(3) HexNAc(5) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1962] === UNIMOD:1962 Hex(10)HexNAc(1) |
null .Term [UNIMOD:1962] [cols="2*"] |
| id | UNIMOD:1962 | name | Hex(10)HexNAc(1) | def | "Hex(10) HexNAc(1)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=10&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1962] | xref | record_id "1962" | xref | delta_mono_mass "1823.607608" | xref | delta_avge_mass "1824.5985" | xref | delta_composition "Hex(10) HexNAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:46:44" | xref | date_time_modified "2017-11-24 13:46:44" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1824_mono_mass "1823.607608" | xref | spec_1_neutral_loss_1824_avge_mass "1824.5985" | xref | spec_1_neutral_loss_1824_flag "false" | xref | spec_1_neutral_loss_1824_composition "Hex(10) HexNAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1963] === UNIMOD:1963 dHex(1)Hex(8)HexNAc(2) |
null .Term [UNIMOD:1963] [cols="2*"] |
| id | UNIMOD:1963 | name | dHex(1)Hex(8)HexNAc(2) | def | "DHex Hex(8) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=8&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1963] | xref | record_id "1963" | xref | delta_mono_mass "1848.639242" | xref | delta_avge_mass "1849.651" | xref | delta_composition "dHex Hex(8) HexNAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:48:48" | xref | date_time_modified "2017-11-24 13:48:48" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1849_mono_mass "1848.639242" | xref | spec_1_neutral_loss_1849_avge_mass "1849.651" | xref | spec_1_neutral_loss_1849_flag "false" | xref | spec_1_neutral_loss_1849_composition "dHex Hex(8) HexNAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1964] === UNIMOD:1964 Hex(3)HexNAc(4)NeuAc(2) |
null .Term [UNIMOD:1964] [cols="2*"] |
| id | UNIMOD:1964 | name | Hex(3)HexNAc(4)NeuAc(2) | def | "Hex(3) HexNAc(4) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=4&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1964] | xref | record_id "1964" | xref | delta_mono_mass "1880.666794" | xref | delta_avge_mass "1881.701" | xref | delta_composition "Hex(3) HexNAc(4) NeuAc(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:50:19" | xref | date_time_modified "2017-11-24 13:50:19" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1881_mono_mass "1880.666794" | xref | spec_1_neutral_loss_1881_avge_mass "1881.701" | xref | spec_1_neutral_loss_1881_flag "false" | xref | spec_1_neutral_loss_1881_composition "Hex(3) HexNAc(4) NeuAc(2)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1965] === UNIMOD:1965 dHex(2)Hex(3)HexNAc(4)NeuAc(1) |
null .Term [UNIMOD:1965] [cols="2*"] |
| id | UNIMOD:1965 | name | dHex(2)Hex(3)HexNAc(4)NeuAc(1) | def | "DHex(2) Hex(3) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1965] | xref | record_id "1965" | xref | delta_mono_mass "1881.687195" | xref | delta_avge_mass "1882.7289" | xref | delta_composition "dHex(2) Hex(3) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 13:55:45" | xref | date_time_modified "2017-11-24 13:56:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1882_mono_mass "1881.687195" | xref | spec_1_neutral_loss_1882_avge_mass "1882.7289" | xref | spec_1_neutral_loss_1882_flag "false" | xref | spec_1_neutral_loss_1882_composition "dHex(2) Hex(3) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1966] === UNIMOD:1966 dHex(2)Hex(2)HexNAc(6)Sulf(1) |
null .Term [UNIMOD:1966] [cols="2*"] |
| id | UNIMOD:1966 | name | dHex(2)Hex(2)HexNAc(6)Sulf(1) | def | "DHex(2) Hex(2) HexNAc(6) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1966] | xref | record_id "1966" | xref | delta_mono_mass "1914.654515" | xref | delta_avge_mass "1915.7819" | xref | delta_composition "Sulf dHex(2) Hex(2) HexNAc(6)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 14:01:17" | xref | date_time_modified "2017-11-24 14:01:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1915_mono_mass "1914.654515" | xref | spec_1_neutral_loss_1915_avge_mass "1915.7819" | xref | spec_1_neutral_loss_1915_flag "false" | xref | spec_1_neutral_loss_1915_composition "Sulf dHex(2) Hex(2) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1915_mono_mass "1914.654515" | xref | spec_1_neutral_loss_1915_avge_mass "1915.7819" | xref | spec_1_neutral_loss_1915_flag "false" | xref | spec_1_neutral_loss_1915_composition "Sulf dHex(2) Hex(2) HexNAc(6)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1967] === UNIMOD:1967 Hex(5)HexNAc(4)NeuAc(1)Ac(1) |
null .Term [UNIMOD:1967] [cols="2*"] |
| id | UNIMOD:1967 | name | Hex(5)HexNAc(4)NeuAc(1)Ac(1) | def | "Hex(5) HexNAc(4) NeuAc Ac." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=1&hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1967] | xref | record_id "1967" | xref | delta_mono_mass "1955.687589" | xref | delta_avge_mass "1956.7643" | xref | delta_composition "Ac Hex(5) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 14:03:24" | xref | date_time_modified "2017-11-24 14:04:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1956_mono_mass "1955.687589" | xref | spec_1_neutral_loss_1956_avge_mass "1956.7643" | xref | spec_1_neutral_loss_1956_flag "false" | xref | spec_1_neutral_loss_1956_composition "Ac Hex(5) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1968] === UNIMOD:1968 Hex(3)HexNAc(3)NeuAc(3) |
null .Term [UNIMOD:1968] [cols="2*"] |
| id | UNIMOD:1968 | name | Hex(3)HexNAc(3)NeuAc(3) | def | "Hex(3) HexNAc(3) NeuAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&neuac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1968] | xref | record_id "1968" | xref | delta_mono_mass "1968.682838" | xref | delta_avge_mass "1969.7631" | xref | delta_composition "Hex(3) HexNAc(3) NeuAc(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 14:05:50" | xref | date_time_modified "2017-11-24 14:05:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1969_mono_mass "1968.682838" | xref | spec_1_neutral_loss_1969_avge_mass "1969.7631" | xref | spec_1_neutral_loss_1969_flag "false" | xref | spec_1_neutral_loss_1969_composition "Hex(3) HexNAc(3) NeuAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_1969_mono_mass "1968.682838" | xref | spec_1_neutral_loss_1969_avge_mass "1969.7631" | xref | spec_1_neutral_loss_1969_flag "false" | xref | spec_1_neutral_loss_1969_composition "Hex(3) HexNAc(3) NeuAc(3)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1969] === UNIMOD:1969 Hex(5)HexNAc(4)NeuAc(1)Ac(2) |
null .Term [UNIMOD:1969] [cols="2*"] |
| id | UNIMOD:1969 | name | Hex(5)HexNAc(4)NeuAc(1)Ac(2) | def | "Hex(5) HexNAc(4) NeuAc Ac(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=2&hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1969] | xref | record_id "1969" | xref | delta_mono_mass "1997.698154" | xref | delta_avge_mass "1998.801" | xref | delta_composition "Ac(2) Hex(5) HexNAc(4) NeuAc" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-11-24 14:06:47" | xref | date_time_modified "2017-11-24 14:06:47" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "N-linked glycosylation" | xref | spec_1_neutral_loss_1998_mono_mass "1997.698154" | xref | spec_1_neutral_loss_1998_avge_mass "1998.801" | xref | spec_1_neutral_loss_1998_flag "false" | xref | spec_1_neutral_loss_1998_composition "Ac(2) Hex(5) HexNAc(4) NeuAc" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1970] === UNIMOD:1970 Unknown:162 |
null .Term [UNIMOD:1970] [cols="2*"] |
| id | UNIMOD:1970 | name | Unknown:162 | def | "Unidentified modification of 162.1258 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1970] | synonym | "The elemental composition should be assumed incorrect Although it happens to be that of Diethylene glycol butyl ether, a common solvent." [] | xref | record_id "1970" | xref | delta_mono_mass "162.125595" | xref | delta_avge_mass "162.2267" | xref | delta_composition "H(18) C(8) O(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 09:51:01" | xref | date_time_modified "2018-10-17 14:27:53" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1971] === UNIMOD:1971 Unknown:177 |
null .Term [UNIMOD:1971] [cols="2*"] |
| id | UNIMOD:1971 | name | Unknown:177 | def | "Unidentified modification of 176.7462 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1971] | synonym | "The elemental composition should be assumed incorrect" [] | xref | record_id "1971" | xref | delta_mono_mass "176.744957" | xref | delta_avge_mass "176.4788" | xref | delta_composition "H(-7) O Fe(3)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 09:53:27" | xref | date_time_modified "2017-12-07 09:53:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1972] === UNIMOD:1972 Unknown:210 |
null .Term [UNIMOD:1972] [cols="2*"] |
| id | UNIMOD:1972 | name | Unknown:210 | def | "Unidentified modification of 210.1616 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1972] | synonym | "The elemental composition should be assumed incorrect" [] | xref | record_id "1972" | xref | delta_mono_mass "210.16198" | xref | delta_avge_mass "210.3126" | xref | delta_composition "H(22) C(13) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 09:55:06" | xref | date_time_modified "2017-12-07 09:55:06" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1973] === UNIMOD:1973 Unknown:216 |
null .Term [UNIMOD:1973] [cols="2*"] |
| id | UNIMOD:1973 | name | Unknown:216 | def | "Unidentified modification of 216.1002 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1973] | synonym | "The elemental composition should be assumed incorrect" [] | xref | record_id "1973" | xref | delta_mono_mass "216.099774" | xref | delta_avge_mass "216.231" | xref | delta_composition "H(16) C(10) O(5)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 09:59:22" | xref | date_time_modified "2017-12-07 09:59:22" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1974] === UNIMOD:1974 Unknown:234 |
null .Term [UNIMOD:1974] [cols="2*"] |
| id | UNIMOD:1974 | name | Unknown:234 | def | "Unidentified modification of 234.0742 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1974] | synonym | "The elemental composition should be assumed incorrect" [] | xref | record_id "1974" | xref | delta_mono_mass "234.073953" | xref | delta_avge_mass "234.2033" | xref | delta_composition "H(14) C(9) O(7)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 10:00:16" | xref | date_time_modified "2017-12-07 10:00:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1975] === UNIMOD:1975 Unknown:248 |
null .Term [UNIMOD:1975] [cols="2*"] |
| id | UNIMOD:1975 | name | Unknown:248 | def | "Unidentified modification of 248.1986 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1975] | synonym | "The elemental composition should be assumed incorrect" [] | xref | record_id "1975" | xref | delta_mono_mass "248.19876" | xref | delta_avge_mass "248.359" | xref | delta_composition "H(28) C(13) O(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 10:00:57" | xref | date_time_modified "2017-12-07 10:00:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1976] === UNIMOD:1976 Unknown:250 |
null .Term [UNIMOD:1976] [cols="2*"] |
| id | UNIMOD:1976 | name | Unknown:250 | def | "Unidentified modification of 249.981 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1976] | synonym | "The elemental composition should be assumed incorrect" [] | xref | record_id "1976" | xref | delta_mono_mass "249.981018" | xref | delta_avge_mass "250.2075" | xref | delta_composition "H(4) C(10) N O(5) S" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 10:01:43" | xref | date_time_modified "2017-12-07 10:01:43" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1977] === UNIMOD:1977 Unknown:302 |
null .Term [UNIMOD:1977] [cols="2*"] |
| id | UNIMOD:1977 | name | Unknown:302 | def | "Unidentified modification of 301.9864 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1977] | synonym | "The elemental composition should be assumed incorrect" [] | xref | record_id "1977" | xref | delta_mono_mass "301.986514" | xref | delta_avge_mass "302.2656" | xref | delta_composition "H(8) C(4) N(5) O(7) S(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 10:02:16" | xref | date_time_modified "2017-12-07 10:02:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1978] === UNIMOD:1978 Unknown:306 |
null .Term [UNIMOD:1978] [cols="2*"] |
| id | UNIMOD:1978 | name | Unknown:306 | def | "Unidentified modification of 306.0952 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1978] | synonym | "The elemental composition should be assumed incorrect" [] | xref | record_id "1978" | xref | delta_mono_mass "306.095082" | xref | delta_avge_mass "306.2659" | xref | delta_composition "H(18) C(12) O(9)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 10:03:12" | xref | date_time_modified "2017-12-07 10:03:12" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "D" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "E" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "C-term" | xref | spec_2_position "Any C-term" | xref | spec_2_classification "Artefact" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1979] === UNIMOD:1979 Unknown:420 |
null .Term [UNIMOD:1979] [cols="2*"] |
| id | UNIMOD:1979 | name | Unknown:420 | def | "Unidentified modification of 420.0506 found in open search." [URL:http\://www.matrixscience.com/blog/results-round-up-for-the-dark-matter-challenge.html, URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1979] | synonym | "Probable non-covalent adduct of CAM-DTT-DTT-CAM" [] | xref | record_id "1979" | xref | delta_mono_mass "420.051719" | xref | delta_avge_mass "420.5888" | xref | delta_composition "H(24) C(12) N(2) O(6) S(4)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2017-12-07 10:03:58" | xref | date_time_modified "2019-10-17 16:01:58" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C-term" | xref | spec_1_position "Any C-term" | xref | spec_1_classification "Artefact" | xref | spec_1_neutral_loss_421_mono_mass "420.051719" | xref | spec_1_neutral_loss_421_avge_mass "420.5888" | xref | spec_1_neutral_loss_421_flag "false" | xref | spec_1_neutral_loss_421_composition "H(24) C(12) N(2) O(6) S(4)" | xref | spec_1_neutral_loss_0_mono_mass "0" | xref | spec_1_neutral_loss_0_avge_mass "0" | xref | spec_1_neutral_loss_0_flag "false" | xref | spec_1_neutral_loss_0_composition "0" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Artefact" | xref | spec_2_neutral_loss_0_mono_mass "0" | xref | spec_2_neutral_loss_0_avge_mass "0" | xref | spec_2_neutral_loss_0_flag "false" | xref | spec_2_neutral_loss_0_composition "0" | xref | spec_2_neutral_loss_421_mono_mass "420.051719" | xref | spec_2_neutral_loss_421_avge_mass "420.5888" | xref | spec_2_neutral_loss_421_flag "false" | xref | spec_2_neutral_loss_421_composition "H(24) C(12) N(2) O(6) S(4)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1986] === UNIMOD:1986 Diethylphosphothione |
null .Term [UNIMOD:1986] [cols="2*"] |
| id | UNIMOD:1986 | name | Diethylphosphothione | def | "O-diethylphosphothione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1986] | xref | record_id "1986" | xref | delta_mono_mass "152.006087" | xref | delta_avge_mass "152.1518" | xref | delta_composition "H(9) C(4) O(2) P S" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2018-03-04 15:26:03" | xref | date_time_modified "2018-03-08 13:03:26" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1987] === UNIMOD:1987 Dimethylphosphothione |
null .Term [UNIMOD:1987] [cols="2*"] |
| id | UNIMOD:1987 | name | Dimethylphosphothione | def | "O-dimethylphosphothione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1987] | synonym | "O-ethylphosphothione" [] | xref | record_id "1987" | xref | delta_mono_mass "123.974787" | xref | delta_avge_mass "124.0987" | xref | delta_composition "H(5) C(2) O(2) P S" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2018-03-04 15:31:14" | xref | date_time_modified "2018-03-08 13:02:30" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1989] === UNIMOD:1989 monomethylphosphothione |
null .Term [UNIMOD:1989] [cols="2*"] |
| id | UNIMOD:1989 | name | monomethylphosphothione | def | "O-methylphosphothione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1989] | comment | Created by auto-catalytic dealkylation of the O-dimethylphosphothione adduct. | xref | record_id "1989" | xref | delta_mono_mass "109.959137" | xref | delta_avge_mass "110.0721" | xref | delta_composition "H(3) C O(2) P S" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2018-03-04 16:13:58" | xref | date_time_modified "2018-03-08 13:04:11" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1990] === UNIMOD:1990 CIGG |
null .Term [UNIMOD:1990] [cols="2*"] |
| id | UNIMOD:1990 | name | CIGG | def | "Ubiquitin D (FAT10) leaving after chymotrypsin digestion Cys-Ile-Gly-Gly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1990] | xref | record_id "1990" | xref | delta_mono_mass "330.136176" | xref | delta_avge_mass "330.4032" | xref | delta_composition "H(22) C(13) N(4) O(4) S" | xref | username_of_poster "cosmoguidry" | xref | group_of_poster "" | xref | date_time_posted "2018-03-13 12:00:08" | xref | date_time_modified "2018-03-16 10:22:17" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1991] === UNIMOD:1991 GNLLFLACYCIGG |
null .Term [UNIMOD:1991] [cols="2*"] |
| id | UNIMOD:1991 | name | GNLLFLACYCIGG | def | "Ubiquitin D (FAT10) leaving after trypsin digestion Gly-Asn-Leu-Leu-Phe-Leu-Ala-Cys-Tyr-Cys-Ile-Gly-Gly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1991] | xref | record_id "1991" | xref | delta_mono_mass "1324.6308" | xref | delta_avge_mass "1325.598" | xref | delta_composition "H(92) C(61) N(14) O(15) S(2)" | xref | username_of_poster "cosmoguidry" | xref | group_of_poster "" | xref | date_time_posted "2018-03-15 15:07:14" | xref | date_time_modified "2018-03-16 10:21:49" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1992] === UNIMOD:1992 serotonylation |
null .Term [UNIMOD:1992] [cols="2*"] |
| id | UNIMOD:1992 | name | serotonylation | def | "5-glutamyl serotonin." [RESID:AA0528, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1992] | xref | record_id "1992" | xref | delta_mono_mass "159.068414" | xref | delta_avge_mass "159.1846" | xref | delta_composition "H(9) C(10) N O" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2018-04-17 09:27:35" | xref | date_time_modified "2018-04-17 09:27:35" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Q" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1993] === UNIMOD:1993 TMPP-Ac:13C(9) |
null .Term [UNIMOD:1993] [cols="2*"] |
| id | UNIMOD:1993 | name | TMPP-Ac:13C(9) | def | "Heavy tris(2,4,6-trimethoxyphenyl)phosphonium acetic acid N-hydroxysuccinimide ester derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1993] | comment | The formula is reduced from H(34) to H(33) so as to give correct observed m/z values. The charge on the TMPP means that ions have one less proton than would be expected. | xref | record_id "1993" | xref | delta_mono_mass "581.211328" | xref | delta_avge_mass "581.474" | xref | delta_composition "H(33) C(20) 13C(9) O(10) P" | xref | username_of_poster "rompais" | xref | group_of_poster "" | xref | date_time_posted "2018-06-26 13:54:23" | xref | date_time_modified "2018-06-26 15:21:14" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "N-term" | xref | spec_1_position "Any N-term" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "K" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Artefact" | xref | spec_2_misc_notes "possible side chain reaction when labeling N-term" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "Y" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Artefact" | xref | spec_3_misc_notes "possible side chain reaction when labeling N-term" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:1999] === UNIMOD:1999 X56 |
null .Term [UNIMOD:1999] [cols="2*"] |
| id | UNIMOD:1999 | name | X56 | def | "DST crosslinker cleaved by sodium periodate." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011282_DST_UG.pdf, PMID:212103, PMID:3001048, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1999] | xref | record_id "1999" | xref | delta_mono_mass "55.989829" | xref | delta_avge_mass "56.0202" | xref | delta_composition "C(2) O(2)" | xref | username_of_poster "unimod" | xref | group_of_poster "" | xref | date_time_posted "2018-08-29 11:31:26" | xref | date_time_modified "2018-08-29 11:37:13" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2001] === UNIMOD:2001 ZQG |
null .Term [UNIMOD:2001] [cols="2*"] |
| id | UNIMOD:2001 | name | ZQG | def | "Carbobenzoxy-L-glutaminyl-glycine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2001] | comment | Glutamine-donor substrate for transglutaminase. | xref | record_id "2001" | xref | delta_mono_mass "320.100836" | xref | delta_avge_mass "320.2973" | xref | delta_composition "H(16) C(15) N(2) O(6)" | xref | username_of_poster "Barbara Spolaore" | xref | group_of_poster "" | xref | date_time_posted "2018-09-18 12:01:47" | xref | date_time_modified "2019-06-05 10:18:16" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_1_neutral_loss_135_mono_mass "134.036779" | xref | spec_1_neutral_loss_135_avge_mass "134.132" | xref | spec_1_neutral_loss_135_flag "false" | xref | spec_1_neutral_loss_135_composition "H(6) C(8) O(2)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2006] === UNIMOD:2006 Haloxon |
null .Term [UNIMOD:2006] [cols="2*"] |
| id | UNIMOD:2006 | name | Haloxon | def | "O-Dichloroethylphosphate." [PMID:4677141, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2006] | xref | record_id "2006" | xref | delta_mono_mass "203.950987" | xref | delta_avge_mass "204.9763" | xref | delta_composition "H(7) C(4) O(3) P Cl(2)" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2019-03-21 14:40:01" | xref | date_time_modified "2019-03-21 15:45:39" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "T" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "Y" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2007] === UNIMOD:2007 Methamidophos-S |
null .Term [UNIMOD:2007] [cols="2*"] |
| id | UNIMOD:2007 | name | Methamidophos-S | def | "S-methyl amino phosphinate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2007] | xref | record_id "2007" | xref | delta_mono_mass "108.975121" | xref | delta_avge_mass "109.0873" | xref | delta_composition "H(4) C N O P S" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2019-03-22 16:54:28" | xref | date_time_modified "2019-05-22 14:56:50" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2008] === UNIMOD:2008 Methamidophos-O |
null .Term [UNIMOD:2008] [cols="2*"] |
| id | UNIMOD:2008 | name | Methamidophos-O | def | "O-methyl amino phosphinate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2008] | xref | record_id "2008" | xref | delta_mono_mass "92.997965" | xref | delta_avge_mass "93.0217" | xref | delta_composition "H(4) C N O(2) P" | xref | username_of_poster "lmschopfer" | xref | group_of_poster "" | xref | date_time_posted "2019-03-22 17:03:48" | xref | date_time_modified "2019-05-22 14:57:05" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "H" | xref | spec_2_position "Anywhere" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "K" | xref | spec_3_position "Anywhere" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "S" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "T" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "Y" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2014] === UNIMOD:2014 Nitrene |
null .Term [UNIMOD:2014] [cols="2*"] |
| id | UNIMOD:2014 | name | Nitrene | def | "Loss of O2; nitro photochemical decomposition." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2014] | xref | record_id "2014" | xref | delta_mono_mass "12.995249" | xref | delta_avge_mass "12.9988" | xref | delta_composition "H(-1) N" | xref | username_of_poster "alhansen" | xref | group_of_poster "" | xref | date_time_posted "2019-07-10 21:24:33" | xref | date_time_modified "2019-09-10 09:30:40" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "Y" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Artefact" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2015] === UNIMOD:2015 shTMT |
null .Term [UNIMOD:2015] [cols="2*"] |
| id | UNIMOD:2015 | name | shTMT | def | "Super Heavy Tandem Mass Tag." [URL:https\://www.thermofisher.com/order/catalog/product/A43073, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2015] | comment | This modification describes the Super Heavy TMT Reagent. Upon HCD, this reagent releases a reporter ion of 132.14153 (monoisotopic mass). | synonym | "Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc. Super Heavy TMT" [] | xref | record_id "2015" | xref | delta_mono_mass "235.176741" | xref | delta_avge_mass "235.2201" | xref | delta_composition "H(20) C(3) 13C(9) 15N(2) O(2)" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2019-07-10 21:42:41" | xref | date_time_modified "2019-09-10 09:30:18" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Protein N-term" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Any N-term" | xref | spec_3_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2016] === UNIMOD:2016 TMTpro |
null .Term [UNIMOD:2016] [cols="2*"] |
| id | UNIMOD:2016 | name | TMTpro | def | "TMTpro 16plex Tandem Mass Tag." [URL:https\://www.thermofisher.com/order/catalog/product/A44520, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2016] | comment | This modification describes the isotope-labeled TMTpro Reagent with m/z values of the TMTpro fragment ions to be quantified for 16plex: 126.127726,127. 124761, 127.131081, 128.128116, 128.134436, 129.131471, 129.13779, 130.134825, 130.141145, 131.13818, 131.1445, 132.141535, 132.147855, 133.14489, 133.15121, and 134.148245. | synonym | "Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc." [] | xref | record_id "2016" | xref | delta_mono_mass "304.207146" | xref | delta_avge_mass "304.3127" | xref | delta_composition "H(25) C(8) 13C(7) N 15N(2) O(3)" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2019-09-06 19:43:32" | xref | date_time_modified "2019-09-10 09:11:27" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "0" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Isotopic label" | xref | spec_2_group "2" | xref | spec_2_hidden "0" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Isotopic label" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Isotopic label" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Isotopic label" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Isotopic label" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Isotopic label" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2017] === UNIMOD:2017 TMTpro_zero |
null .Term [UNIMOD:2017] [cols="2*"] |
| id | UNIMOD:2017 | name | TMTpro_zero | def | "Native TMTpro Tandem Mass Tag." [URL:https\://www.thermofisher.com/order/catalog/product/A44518, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2017] | comment | This modification describes the native TMTpro Reagent without isotopic label with reporter mass m/z 126.127726. | synonym | "Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc." [] | xref | record_id "2017" | xref | delta_mono_mass "295.189592" | xref | delta_avge_mass "295.3773" | xref | delta_composition "H(25) C(15) N(3) O(3)" | xref | username_of_poster "rbomgard" | xref | group_of_poster "" | xref | date_time_posted "2019-09-06 20:04:30" | xref | date_time_modified "2019-09-10 09:10:52" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "K" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | xref | spec_2_group "2" | xref | spec_2_hidden "1" | xref | spec_2_site "N-term" | xref | spec_2_position "Any N-term" | xref | spec_2_classification "Chemical derivative" | xref | spec_3_group "3" | xref | spec_3_hidden "1" | xref | spec_3_site "N-term" | xref | spec_3_position "Protein N-term" | xref | spec_3_classification "Chemical derivative" | xref | spec_4_group "4" | xref | spec_4_hidden "1" | xref | spec_4_site "H" | xref | spec_4_position "Anywhere" | xref | spec_4_classification "Chemical derivative" | xref | spec_5_group "5" | xref | spec_5_hidden "1" | xref | spec_5_site "S" | xref | spec_5_position "Anywhere" | xref | spec_5_classification "Chemical derivative" | xref | spec_6_group "6" | xref | spec_6_hidden "1" | xref | spec_6_site "T" | xref | spec_6_position "Anywhere" | xref | spec_6_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2022] === UNIMOD:2022 Kdo |
null .Term [UNIMOD:2022] [cols="2*"] |
| id | UNIMOD:2022 | name | Kdo | def | "Glycosylation with KDO." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2022] | comment | Manuscript ; in preparation \"Protein O-sialylation by recombinant Gram-positive bacterial flagellin glycosyltransferases heterologously expressed in Escherichia coli\" by Aasawari Khairnar1, Sonali Sunsunwal1, Babu Ponnuswamy2, and T. N. C. Ramya1. rn1CSIR-Institute of Microbial Technology, Sector 39-A, Chandigarh 160036, INDIArn2Centre for Cellular and Molecular Platforms, Bengaluru, INDIArnThis is the primary reference and only report to our knowledge of KDO modification on protein. We will link this primary reference when published. | synonym | "2-Keto-3-Deoxy-D-Mannooctanoic Acid 3-deoxy-D-manno-oct-2-ulosonic acid" [] | xref | record_id "2022" | xref | delta_mono_mass "220.058303" | xref | delta_avge_mass "220.1767" | xref | delta_composition "H(12) C(8) O(7)" | xref | username_of_poster "ramya" | xref | group_of_poster "" | xref | date_time_posted "2020-02-13 12:07:17" | xref | date_time_modified "2020-03-20 08:56:20" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "T" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_221_mono_mass "220.058303" | xref | spec_1_neutral_loss_221_avge_mass "220.1767" | xref | spec_1_neutral_loss_221_flag "false" | xref | spec_1_neutral_loss_221_composition "H(12) C(8) O(7)" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "S" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "O-linked glycosylation" | xref | spec_1_neutral_loss_221_mono_mass "220.058303" | xref | spec_1_neutral_loss_221_avge_mass "220.1767" | xref | spec_1_neutral_loss_221_flag "false" | xref | spec_1_neutral_loss_221_composition "H(12) C(8) O(7)" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2025] === UNIMOD:2025 Andro-H2O |
null .Term [UNIMOD:2025] [cols="2*"] |
| id | UNIMOD:2025 | name | Andro-H2O | def | "Andrographolide with the loss of H2O." [PMID:24445406, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2025] | xref | record_id "2025" | xref | delta_mono_mass "332.19876" | xref | delta_avge_mass "332.4339" | xref | delta_composition "H(28) C(20) O(4)" | xref | username_of_poster "nekoooooo" | xref | group_of_poster "" | xref | date_time_posted "2020-05-18 08:48:39" | xref | date_time_modified "2020-05-26 15:47:33" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "C" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Chemical derivative" | is_a | [UNIMOD:0] ! unimod root node
[#UNIMOD:2027] === UNIMOD:2027 His+O(2) |
null .Term [UNIMOD:2027] [cols="2*"] |
| id | UNIMOD:2027 | name | His+O(2) | def | "Photo-induced histidine adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2027] | xref | record_id "2027" | xref | delta_mono_mass "169.048741" | xref | delta_avge_mass "169.1381" | xref | delta_composition "H(7) C(6) N(3) O(3)" | xref | username_of_poster "tomp1808" | xref | group_of_poster "" | xref | date_time_posted "2020-06-01 16:45:37" | xref | date_time_modified "2020-06-09 11:01:57" | xref | approved "0" | xref | spec_1_group "1" | xref | spec_1_hidden "1" | xref | spec_1_site "H" | xref | spec_1_position "Anywhere" | xref | spec_1_classification "Post-translational" | is_a | [UNIMOD:0] ! unimod root node
[#null] === null null |